BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 027132
(227 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q94B78|GCSP2_ARATH Glycine dehydrogenase [decarboxylating] 2, mitochondrial
OS=Arabidopsis thaliana GN=At4g33010 PE=1 SV=2
Length = 1037
Score = 33.9 bits (76), Expect = 1.0, Method: Composition-based stats.
Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 5/56 (8%)
Query: 22 PRLFPHRPAKFSANLNNFRTLQRTTTARNFNGVKCFCRPQNIESSSTSSASPDRFF 77
P L PH PA++ ++L+ F +T R+ N F R Q S S + P F
Sbjct: 29 PHLVPHAPARYVSSLSPF-----ISTPRSVNHTAAFGRHQQTRSISVDAVKPSDTF 79
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.320 0.133 0.391
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 79,156,918
Number of Sequences: 539616
Number of extensions: 3208747
Number of successful extensions: 14400
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 49
Number of HSP's that attempted gapping in prelim test: 12077
Number of HSP's gapped (non-prelim): 2286
length of query: 227
length of database: 191,569,459
effective HSP length: 113
effective length of query: 114
effective length of database: 130,592,851
effective search space: 14887585014
effective search space used: 14887585014
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)