BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027132
         (227 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q94B78|GCSP2_ARATH Glycine dehydrogenase [decarboxylating] 2, mitochondrial
          OS=Arabidopsis thaliana GN=At4g33010 PE=1 SV=2
          Length = 1037

 Score = 33.9 bits (76), Expect = 1.0,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 5/56 (8%)

Query: 22 PRLFPHRPAKFSANLNNFRTLQRTTTARNFNGVKCFCRPQNIESSSTSSASPDRFF 77
          P L PH PA++ ++L+ F      +T R+ N    F R Q   S S  +  P   F
Sbjct: 29 PHLVPHAPARYVSSLSPF-----ISTPRSVNHTAAFGRHQQTRSISVDAVKPSDTF 79


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.320    0.133    0.391 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 79,156,918
Number of Sequences: 539616
Number of extensions: 3208747
Number of successful extensions: 14400
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 49
Number of HSP's that attempted gapping in prelim test: 12077
Number of HSP's gapped (non-prelim): 2286
length of query: 227
length of database: 191,569,459
effective HSP length: 113
effective length of query: 114
effective length of database: 130,592,851
effective search space: 14887585014
effective search space used: 14887585014
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)