Citrus Sinensis ID: 027139

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MSRRPVSSTRRLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPVSGILLLCYPLFRLD
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccEEccccccccHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccEEEEEEccccccccccccEEEEccccccccHHHHHHccHHHHHHccccEEEEEcccccccHHHHHHcccccccccEEEEEECccccc
********************************LLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPVSGILLLCYPLFRLD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRRPVSSTRRLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPVSGILLLCYPLFRLD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized protein At3g49720 confidentQ9M2Y6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VE3, chain A
Confidence level:confident
Coverage over the Query: 77-193
View the alignment between query and template
View the model in PyMOL
Template: 2YXD, chain A
Confidence level:probable
Coverage over the Query: 106-213
View the alignment between query and template
View the model in PyMOL