BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027182
         (227 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3TF5|A Chain A, Structure Of Udp-Glucose Dehydrogenase V132 Deletion
 pdb|3TF5|B Chain B, Structure Of Udp-Glucose Dehydrogenase V132 Deletion
 pdb|3TF5|C Chain C, Structure Of Udp-Glucose Dehydrogenase V132 Deletion
          Length = 493

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 62  EEVSQFDLVLVHIGAGEKTNDDKGKAVAHDLEYINALVRVILQ 104
           + + + DLV + +    KT    GK  A DL+YI A  R I+Q
Sbjct: 77  DAIKEADLVFISVNTPTKTYG-MGKGRAADLKYIEACARRIVQ 118


>pdb|3PRJ|A Chain A, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase.
 pdb|3PRJ|B Chain B, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase.
 pdb|3PRJ|C Chain C, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase.
 pdb|3PRJ|D Chain D, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase.
 pdb|3PRJ|E Chain E, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase.
 pdb|3PRJ|F Chain F, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase.
 pdb|3PTZ|A Chain A, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase.
 pdb|3PTZ|B Chain B, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase.
 pdb|3PTZ|C Chain C, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase.
 pdb|3PTZ|D Chain D, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase.
 pdb|3PTZ|E Chain E, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase.
 pdb|3PTZ|F Chain F, Role Of Packing Defects In The Evolution Of Allostery And
           Induced Fit In Human Udp-Glucose Dehydrogenase
          Length = 494

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 62  EEVSQFDLVLVHIGAGEKTNDDKGKAVAHDLEYINALVRVILQ 104
           + + + DLV + +    KT    GK  A DL+YI A  R I+Q
Sbjct: 77  DAIKEADLVFISVNTPTKTYG-MGKGRAADLKYIEACARRIVQ 118


>pdb|3TDK|A Chain A, Crystal Structure Of Human Udp-Glucose Dehydrogenase
 pdb|3TDK|B Chain B, Crystal Structure Of Human Udp-Glucose Dehydrogenase
 pdb|3TDK|G Chain G, Crystal Structure Of Human Udp-Glucose Dehydrogenase
 pdb|3TDK|H Chain H, Crystal Structure Of Human Udp-Glucose Dehydrogenase
 pdb|3TDK|L Chain L, Crystal Structure Of Human Udp-Glucose Dehydrogenase
 pdb|3TDK|K Chain K, Crystal Structure Of Human Udp-Glucose Dehydrogenase
 pdb|3TDK|F Chain F, Crystal Structure Of Human Udp-Glucose Dehydrogenase
 pdb|3TDK|E Chain E, Crystal Structure Of Human Udp-Glucose Dehydrogenase
 pdb|3TDK|D Chain D, Crystal Structure Of Human Udp-Glucose Dehydrogenase
 pdb|3TDK|C Chain C, Crystal Structure Of Human Udp-Glucose Dehydrogenase
 pdb|3TDK|J Chain J, Crystal Structure Of Human Udp-Glucose Dehydrogenase
 pdb|3TDK|I Chain I, Crystal Structure Of Human Udp-Glucose Dehydrogenase
          Length = 487

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 62  EEVSQFDLVLVHIGAGEKTNDDKGKAVAHDLEYINALVRVILQ 104
           + + + DLV + +    KT    GK  A DL+YI A  R I+Q
Sbjct: 77  DAIKEADLVFISVNTPTKTYG-MGKGRAADLKYIEACARRIVQ 118


>pdb|2Q3E|A Chain A, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2Q3E|B Chain B, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2Q3E|C Chain C, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2Q3E|D Chain D, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2Q3E|E Chain E, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2Q3E|F Chain F, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2Q3E|G Chain G, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2Q3E|H Chain H, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2Q3E|I Chain I, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2Q3E|J Chain J, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2Q3E|K Chain K, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2Q3E|L Chain L, Structure Of Human Udp-Glucose Dehydrogenase Complexed
           With Nadh And Udp-Glucose
 pdb|2QG4|A Chain A, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Product Complex With Udp-Glucuronate
 pdb|2QG4|B Chain B, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Product Complex With Udp-Glucuronate
 pdb|2QG4|C Chain C, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Product Complex With Udp-Glucuronate
 pdb|2QG4|D Chain D, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Product Complex With Udp-Glucuronate
 pdb|2QG4|E Chain E, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Product Complex With Udp-Glucuronate
 pdb|2QG4|F Chain F, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Product Complex With Udp-Glucuronate
 pdb|2QG4|G Chain G, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Product Complex With Udp-Glucuronate
 pdb|2QG4|H Chain H, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Product Complex With Udp-Glucuronate
          Length = 467

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 62  EEVSQFDLVLVHIGAGEKTNDDKGKAVAHDLEYINALVRVILQ 104
           + + + DLV + +    KT    GK  A DL+YI A  R I+Q
Sbjct: 78  DAIKEADLVFISVNTPTKTYG-MGKGRAADLKYIEACARRIVQ 119


>pdb|3KHU|A Chain A, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Glu161gln, In Complex With Thiohemiacetal Intermediate
 pdb|3KHU|B Chain B, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Glu161gln, In Complex With Thiohemiacetal Intermediate
 pdb|3KHU|C Chain C, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Glu161gln, In Complex With Thiohemiacetal Intermediate
 pdb|3KHU|D Chain D, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Glu161gln, In Complex With Thiohemiacetal Intermediate
 pdb|3KHU|E Chain E, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Glu161gln, In Complex With Thiohemiacetal Intermediate
 pdb|3KHU|F Chain F, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Glu161gln, In Complex With Thiohemiacetal Intermediate
          Length = 467

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 62  EEVSQFDLVLVHIGAGEKTNDDKGKAVAHDLEYINALVRVILQ 104
           + + + DLV + +    KT    GK  A DL+YI A  R I+Q
Sbjct: 78  DAIKEADLVFISVNTPTKTYG-MGKGRAADLKYIEACARRIVQ 119


>pdb|3ITK|A Chain A, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Thr131ala, Apo Form.
 pdb|3ITK|B Chain B, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Thr131ala, Apo Form.
 pdb|3ITK|C Chain C, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Thr131ala, Apo Form.
 pdb|3ITK|D Chain D, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Thr131ala, Apo Form.
 pdb|3ITK|E Chain E, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Thr131ala, Apo Form.
 pdb|3ITK|F Chain F, Crystal Structure Of Human Udp-Glucose Dehydrogenase
           Thr131ala, Apo Form
          Length = 467

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 62  EEVSQFDLVLVHIGAGEKTNDDKGKAVAHDLEYINALVRVILQ 104
           + + + DLV + +    KT    GK  A DL+YI A  R I+Q
Sbjct: 78  DAIKEADLVFISVNTPTKTYG-MGKGRAADLKYIEACARRIVQ 119


>pdb|2O3J|A Chain A, Structure Of Caenorhabditis Elegans Udp-Glucose
           Dehydrogenase
 pdb|2O3J|B Chain B, Structure Of Caenorhabditis Elegans Udp-Glucose
           Dehydrogenase
 pdb|2O3J|C Chain C, Structure Of Caenorhabditis Elegans Udp-Glucose
           Dehydrogenase
          Length = 481

 Score = 28.1 bits (61), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 64  VSQFDLVLVHIGAGEKTNDDKGKAVAHDLEYINALVRVILQMA 106
           +++ DL+ + +    K    +GK +A DL+Y+ ++ R I Q A
Sbjct: 84  IAEADLIFISVNTPTKMYG-RGKGMAPDLKYVESVSRTIAQYA 125


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.133    0.376 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,425,988
Number of Sequences: 62578
Number of extensions: 243043
Number of successful extensions: 540
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 539
Number of HSP's gapped (non-prelim): 9
length of query: 227
length of database: 14,973,337
effective HSP length: 95
effective length of query: 132
effective length of database: 9,028,427
effective search space: 1191752364
effective search space used: 1191752364
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)