Citrus Sinensis ID: 027190


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MAREKIKIRKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVGVIIFSATGKLFESSSSSMKDIIARYNMHSSNISKLNHPSLELQLENSKYLSLSREIADKSRQLRQMRGEDLHGLTIEELQHLETMLEQGLSRVLQTKGDRIMNEISTLERKGAKLLEENKNLKQKVASSCKGKRVVLVDSDIAIQEEGMSSESVNNVCSCSSGPPPEDDSSDTSLKLGLPYSS
ccccccHHHHHcccccccccccccccccHHHHHHHHHHHcccEEEEEEcccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHccccccccccccccccccccccccccccccccccccccc
MAREKIKIRKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVGVIIFSATGKLFESSSSSMKDIIARYNM*******************SKYLSLSREIADKSRQLRQMRGEDLHGLTIEELQHLETMLEQGLSRVLQTKGDRIMNEISTLERKGAKLLEENKNLK**************************************************S**LGLP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAREKIKIRKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVGVIIFSATGKLFESSSSSMKDIIARYNMHSSNISKLNHPSLELQLENSKxxxxxxxxxxxxxxxxxxxxxDLHGLTIEELQHLETMLEQGLSRVLQTKGDRIMNExxxxxxxxxxxxxxxxxxxxxVASSCKGKRVVLVDSDIAIQEEGMSSESVNNVCSCSSGPPPEDDSSDTSLKLGLPYSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MADS-box protein SVP Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes.probableQ9FVC1
MADS-box transcription factor 22 Probable transcription factor. May be required for spikelet (rice flower) development.probableQ9XJ66
MADS-box protein JOINTLESS Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.probableQ9FUY6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EGW, chain A
Confidence level:very confident
Coverage over the Query: 2-72
View the alignment between query and template
View the model in PyMOL
Template: 2W6A, chain A
Confidence level:probable
Coverage over the Query: 116-168
View the alignment between query and template
View the model in PyMOL