BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027192
         (226 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3EUP|A Chain A, The Crystal Structure Of The Transcriptional Regulator,
           Tetr Family From Cytophaga Hutchinsonii
 pdb|3EUP|B Chain B, The Crystal Structure Of The Transcriptional Regulator,
           Tetr Family From Cytophaga Hutchinsonii
          Length = 204

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 103 YNWGLVRGVTSALVCLPNELKEMLI 127
           YNWG V+ V +A V   N  KEML+
Sbjct: 65  YNWGHVKSVLTAKVQACNTYKEMLL 89


>pdb|3GWD|A Chain A, Closed Crystal Structure Of Cyclohexanone Monooxygenase
 pdb|3GWF|A Chain A, Open Crystal Structure Of Cyclohexanone Monooxygenase
          Length = 540

 Score = 26.9 bits (58), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 54  DIETDLDREWQRRRDQFHTIGYRDGLLAGKETSAQEGFNMGFKESFHSG 102
           +I+ D DR W+R ++     G+ +  L     S +E  N  F+E++  G
Sbjct: 229 EIKADYDRIWERAKNSAVAFGFEESTLPAMSVSEEER-NRIFQEAWDHG 276


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.313    0.131    0.371 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,287,823
Number of Sequences: 62578
Number of extensions: 190333
Number of successful extensions: 440
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 437
Number of HSP's gapped (non-prelim): 10
length of query: 226
length of database: 14,973,337
effective HSP length: 95
effective length of query: 131
effective length of database: 9,028,427
effective search space: 1182723937
effective search space used: 1182723937
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 50 (23.9 bits)