Citrus Sinensis ID: 027196


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MAVAFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRISGVTGEGSGVTVEGSAPVATPPVADSKAAAPDDDDDDVDLFGEETEEEKKAAEARAASVKASAKKKESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI
ccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccccccEEEEcHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccHHHHHHHHcccccccEEEcccccccccCEEEEEEEEEEEEcccccHHHHHHHHHHcccccccccccccEEcccc
*AVAFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRISGVTGEGSGVTVEGSAPVATPP***************************************************LLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVAFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRISGVTGEGSGVTVEGSAPVATPPVADSKAAAPDDDDDDVDLFxxxxxxxxxxxxxxxxxxxxxAKKKESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation factor 1-delta 2 EF-1-beta and EF-1-beta' stimulate the exchange of GDP bound to EF-1-alpha to GTP.confidentQ40682
Elongation factor 1-delta 2 EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.confidentQ9SI20
Elongation factor 1-delta EF-1-beta and EF-1-beta' stimulate the exchange of GDP bound to EF-1-alpha to GTP.probableP93447

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F60, chain B
Confidence level:very confident
Coverage over the Query: 134-226
View the alignment between query and template
View the model in PyMOL
Template: 2UZ8, chain A
Confidence level:confident
Coverage over the Query: 11-67
View the alignment between query and template
View the model in PyMOL