BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027198
         (226 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q8JJY5|CAPSD_SFAVA Major capsid protein OS=Spodoptera frugiperda ascovirus 1a GN=MCP
           PE=3 SV=1
          Length = 461

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 44  VKRKKVKVAARSL-ELGSSFVDSWDDWRLSS---KVISNMVNRSSRKRKQRRDRRPVIV 98
           +K  K+K+  + L EL SSF+D W ++ + S   +  +NMV       K R + + V++
Sbjct: 120 IKSVKLKIDGKPLVELSSSFMDMWSEFMIDSGNYEAYNNMVGGEYEFNKDRINNKSVVL 178


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.319    0.133    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 79,886,062
Number of Sequences: 539616
Number of extensions: 2993368
Number of successful extensions: 8352
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 8352
Number of HSP's gapped (non-prelim): 2
length of query: 226
length of database: 191,569,459
effective HSP length: 113
effective length of query: 113
effective length of database: 130,592,851
effective search space: 14756992163
effective search space used: 14756992163
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)