Citrus Sinensis ID: 027201

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------

MRRSVSRKTGQTNSTDATDLFRSASSKASSKEMERIDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAKQT

ccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHccHHHHHHccccccHHHHHHHHHHHccccccccccHHHHHHcccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcc

ccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHEEEEEEEEccHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccEccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccc

mrrsvsrktgqtnstdatdlfrsasskasSKEMERIDNLFYSYankssgmidpegieslcsdievSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKALPDlekevkrptnfqdFYAFAFRYClteekqksvDIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYrfcneisfpdfnnydpnlawpLVLDNFVEWMKAKQT

mrrsvsrktgqtnstdatdlfrsasskasskemeRIDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKkalpdlekevkrptnfqdFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAKQT

MRRSVSRKTGQTNSTDATDLFRsasskasskEMERIDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAKQT

************************************DNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWM*****

**************************************LFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAK**

**************TDATDLF***********MERIDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAKQT

****************************SSKEMERIDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAK**

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		226	2.2.26 [Sep-21-2011]
Q8CCA0		292	DCN1-like protein 4 OS=Mu	yes	no	0.800	0.619	0.430	5e-34
Q92564		292	DCN1-like protein 4 OS=Ho	yes	no	0.800	0.619	0.424	1e-33
Q5RHX6		280	DCN1-like protein 4 OS=Da	yes	no	0.800	0.646	0.397	9e-32
Q9BTE7		237	DCN1-like protein 5 OS=Ho	no	no	0.805	0.767	0.374	4e-31
Q5PPL2		237	DCN1-like protein 5 OS=Ra	no	no	0.805	0.767	0.374	7e-31
Q9CXV9		237	DCN1-like protein 5 OS=Mu	no	no	0.805	0.767	0.374	8e-31
Q1RMX9		236	DCN1-like protein 5 OS=Bo	yes	no	0.805	0.771	0.368	1e-30
Q5RDF9		237	DCN1-like protein 5 OS=Po	no	no	0.805	0.767	0.368	2e-30
Q5R9G1		304	DCN1-like protein 3 OS=Po	no	no	0.907	0.674	0.346	4e-27
Q8IWE4		304	DCN1-like protein 3 OS=Ho	no	no	0.907	0.674	0.346	4e-27

>sp\|Q8CCA0\|DCNL4_MOUSE DCN1-like protein 4 OS=Mus musculus GN=Dcun1d4 PE=2 SV=1	Back alignment and function desciption

 Score =  144 bits (363), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 112/186 (60%), Gaps = 5/186 (2%)

Query: 40  FYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKAL 99
           FY YA  +   + PEG+E  C DI V   +V +L+LAWK+ A+  GYFTL+EW +G+ +L
Sbjct: 110 FYEYAG-TEDAVGPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMTSL 168

Query: 100 RADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGS 159
           + DT  KL+  L  L   +   TNF+  Y +AF +   E+ Q+S+DI +   +LGL+LG 
Sbjct: 169 QCDTTEKLRTTLDYLRSLLNDTTNFKLIYRYAFDFA-REKDQRSLDINTAKCMLGLLLGK 227

Query: 160 QYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVE 219
            +        ++L+ QS YKVIN DQW     F   IS  D +NYD + AWP++LD FVE
Sbjct: 228 IW-PLFPVFHQFLE-QSKYKVINKDQWCNVLEFSRTISL-DLSNYDEDGAWPVLLDEFVE 284

Query: 220 WMKAKQ 225
           W K KQ
Sbjct: 285 WYKDKQ 290

Mus musculus (taxid: 10090)

>sp\|Q92564\|DCNL4_HUMAN DCN1-like protein 4 OS=Homo sapiens GN=DCUN1D4 PE=1 SV=2	Back alignment and function description

>sp\|Q5RHX6\|DCNL4_DANRE DCN1-like protein 4 OS=Danio rerio GN=dcun1d4 PE=2 SV=2	Back alignment and function description

>sp\|Q9BTE7\|DCNL5_HUMAN DCN1-like protein 5 OS=Homo sapiens GN=DCUN1D5 PE=1 SV=1	Back alignment and function description

>sp\|Q5PPL2\|DCNL5_RAT DCN1-like protein 5 OS=Rattus norvegicus GN=Dcun1d5 PE=2 SV=1	Back alignment and function description

>sp\|Q9CXV9\|DCNL5_MOUSE DCN1-like protein 5 OS=Mus musculus GN=Dcun1d5 PE=2 SV=1	Back alignment and function description

>sp\|Q1RMX9\|DCNL5_BOVIN DCN1-like protein 5 OS=Bos taurus GN=DCUN1D5 PE=2 SV=1	Back alignment and function description

>sp\|Q5RDF9\|DCNL5_PONAB DCN1-like protein 5 OS=Pongo abelii GN=DCUN1D5 PE=2 SV=1	Back alignment and function description

>sp\|Q5R9G1\|DCNL3_PONAB DCN1-like protein 3 OS=Pongo abelii GN=DCUN1D3 PE=2 SV=1	Back alignment and function description

>sp\|Q8IWE4\|DCNL3_HUMAN DCN1-like protein 3 OS=Homo sapiens GN=DCUN1D3 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		226
224072695		232	predicted protein [Populus trichocarpa]	1.0	0.974	0.844	1e-110
224057561		232	predicted protein [Populus trichocarpa]	1.0	0.974	0.844	1e-109
255572771		231	Defective in cullin neddylation protein,	1.0	0.978	0.831	1e-108
225443086		231	PREDICTED: DCN1-like protein 4 isoform 1	1.0	0.978	0.792	1e-105
217074494		228	unknown [Medicago truncatula] gi\|3885005	0.995	0.986	0.765	1e-103
238478498		227	uncharacterized protein [Arabidopsis tha	1.0	0.995	0.770	1e-101
449468930		230	PREDICTED: DCN1-like protein 4-like [Cuc	1.0	0.982	0.786	1e-101
388506842		231	unknown [Lotus japonicus]	1.0	0.978	0.774	1e-100
359482420		212	PREDICTED: DCN1-like protein 4 isoform 2	0.938	1.0	0.765	1e-100
334182605		236	uncharacterized protein [Arabidopsis tha	1.0	0.957	0.741	3e-99

>gi\|224072695\|ref\|XP_002303837.1\| predicted protein [Populus trichocarpa] gi\|222841269\|gb\|EEE78816.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/232 (84%), Positives = 217/232 (93%), Gaps = 6/232 (2%)

Query: 1   MRRSVSRKTGQTNST------DATDLFRSASSKASSKEMERIDNLFYSYANKSSGMIDPE 54
           MRRS S+KTGQ+NST       ATDLFRS+SSKASSKEMERIDNLFYSYAN+SSGMIDPE
Sbjct: 1   MRRSASKKTGQSNSTTASITSSATDLFRSSSSKASSKEMERIDNLFYSYANRSSGMIDPE 60

Query: 55  GIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKALPDL 114
           GIE+LCSD+EV HTDVRILMLAWKM+AEKQGYFTLEEWR+GLK+LRADT+NKLKKALPDL
Sbjct: 61  GIETLCSDMEVDHTDVRILMLAWKMRAEKQGYFTLEEWRQGLKSLRADTLNKLKKALPDL 120

Query: 115 EKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRAQVDYLIEYLKI 174
           EKEVKRP+NF DFY +AFRYCLTEEKQKS+DIES+C+LL LVLGS ++AQVDY IEYLKI
Sbjct: 121 EKEVKRPSNFVDFYNYAFRYCLTEEKQKSIDIESICQLLDLVLGSHFQAQVDYFIEYLKI 180

Query: 175 QSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAKQT 226
           QSDYKVINMDQWMGFYRFCNEISFPDF+NYDP LAWPL+LDNFVEWM+AK+T
Sbjct: 181 QSDYKVINMDQWMGFYRFCNEISFPDFSNYDPELAWPLILDNFVEWMRAKRT 232

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224057561\|ref\|XP_002299268.1\| predicted protein [Populus trichocarpa] gi\|222846526\|gb\|EEE84073.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255572771\|ref\|XP_002527318.1\| Defective in cullin neddylation protein, putative [Ricinus communis] gi\|223533318\|gb\|EEF35070.1\| Defective in cullin neddylation protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225443086\|ref\|XP_002273365.1\| PREDICTED: DCN1-like protein 4 isoform 1 [Vitis vinifera] gi\|297743605\|emb\|CBI36472.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|217074494\|gb\|ACJ85607.1\| unknown [Medicago truncatula] gi\|388500562\|gb\|AFK38347.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|238478498\|ref\|NP_001154344.1\| uncharacterized protein [Arabidopsis thaliana] gi\|240254082\|ref\|NP_563983.4\| uncharacterized protein [Arabidopsis thaliana] gi\|32815875\|gb\|AAP88334.1\| At1g15860 [Arabidopsis thaliana] gi\|332191253\|gb\|AEE29374.1\| uncharacterized protein [Arabidopsis thaliana] gi\|332191254\|gb\|AEE29375.1\| uncharacterized protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|449468930\|ref\|XP_004152174.1\| PREDICTED: DCN1-like protein 4-like [Cucumis sativus] gi\|449527597\|ref\|XP_004170796.1\| PREDICTED: DCN1-like protein 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|388506842\|gb\|AFK41487.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|359482420\|ref\|XP_003632772.1\| PREDICTED: DCN1-like protein 4 isoform 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|334182605\|ref\|NP_001185006.1\| uncharacterized protein [Arabidopsis thaliana] gi\|332191255\|gb\|AEE29376.1\| uncharacterized protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		226
DICTYBASE\|DDB_G0284369		274	DDB_G0284369 "DUF298 family pr	0.827	0.682	0.405	4.9e-37
UNIPROTKB\|B4DH25		336	DCUN1D4 "cDNA FLJ55777, highly	0.800	0.538	0.424	5.1e-35
UNIPROTKB\|Q92564		292	DCUN1D4 "DCN1-like protein 4"	0.800	0.619	0.424	5.1e-35
MGI\|MGI:2140972		292	Dcun1d4 "DCN1, defective in cu	0.800	0.619	0.430	5.1e-35
UNIPROTKB\|Q9BTE7		237	DCUN1D5 "DCN1-like protein 5"	0.805	0.767	0.374	3.2e-33
MGI\|MGI:1924113		237	Dcun1d5 "DCN1, defective in cu	0.805	0.767	0.374	4.1e-33
RGD\|1307008		237	Dcun1d5 "DCN1, defective in cu	0.805	0.767	0.374	4.1e-33
UNIPROTKB\|Q5RDF9		237	DCUN1D5 "DCN1-like protein 5"	0.805	0.767	0.368	1.8e-32
ZFIN\|ZDB-GENE-040426-2603		249	dcun1d5 "DCN1, defective in cu	0.796	0.722	0.351	1.3e-29
UNIPROTKB\|Q8IWE4		304	DCUN1D3 "DCN1-like protein 3"	0.907	0.674	0.336	1.2e-26

DICTYBASE\|DDB_G0284369 DDB_G0284369 "DUF298 family protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

 Score = 398 (145.2 bits), Expect = 4.9e-37, P = 4.9e-37
 Identities = 77/190 (40%), Positives = 117/190 (61%)

Query:    34 ERIDNLFYSYANKS-SGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEW 92
             +RI++ F  Y ++  + +I P+GI  LC D+ V   DV +L+LAW + A++ GYF+  E+
Sbjct:    82 KRIEDFFDKYKDEDDNNVIGPDGITRLCKDLGVEPEDVVVLVLAWHLGAKQMGYFSKAEF 141

Query:    93 RRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCEL 152
              +GL  L  D++ KL++ LP  +K++  P NF+D Y FAF +    E  K +D+ES C +
Sbjct:   142 TQGLSKLNIDSLQKLQQHLPTFKKDLDNPNNFKDIYRFAFIFAKENENNKILDLESACSM 201

Query:   153 LGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPL 212
             L LVL  +Y    + L E+L  Q  YKV+NMDQW+    F   I+  + +NYD N AWP+
Sbjct:   202 LQLVLADRY-PHTEKLQEFLMQQKSYKVLNMDQWLSILEFSKIIN-ANCSNYDENGAWPV 259

Query:   213 VLDNFVEWMK 222
             +LD + EW K
Sbjct:   260 LLDEYSEWRK 269

GO:0008150 "biological_process" evidence=ND

GO:0005575 "cellular_component" evidence=ND

UNIPROTKB\|B4DH25 DCUN1D4 "cDNA FLJ55777, highly similar to DCN1-like protein 4" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q92564 DCUN1D4 "DCN1-like protein 4" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:2140972 Dcun1d4 "DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9BTE7 DCUN1D5 "DCN1-like protein 5" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1924113 Dcun1d5 "DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1307008 Dcun1d5 "DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5RDF9 DCUN1D5 "DCN1-like protein 5" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-2603 dcun1d5 "DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8IWE4 DCUN1D3 "DCN1-like protein 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pm.C_LG_III0613	hypothetical protein (232 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		226
pfam03556		117	pfam03556, Cullin_binding, Cullin binding	1e-34

>gnl\|CDD\|217613 pfam03556, Cullin_binding, Cullin binding	Back alignment and domain information

 Score =  119 bits (300), Expect = 1e-34
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 105 NKLKKALPDLEKEVK-RPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRA 163
            KLK  LP+L  E+K  P  F+D Y F F +   EE QKS+D+E+  E   L+ GS+   
Sbjct: 2   EKLKAKLPELRSELKSDPEKFKDLYRFTFDFAR-EEGQKSLDLETAIEYWKLLFGSRTFP 60

Query: 164 QVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMK 222
            +D  IE+L+ +   K I+ D W     F   I   D +NYD   AWP ++D FVEW+K
Sbjct: 61  LLDQWIEFLE-EKHKKSISKDTWNMLLEFSKTID-EDLSNYDEEGAWPSLIDEFVEWLK 117

This domain binds to cullins and to Rbx-1, components of an E3 ubiquitin ligase complex for neddylation. Neddylation is the process by which the C-terminal glycine of the ubiquitin-like protein Nedd8 is covalently linked to lysine residues in a protein through an isopeptide bond. The structure of this domain is composed entirely of alpha helices. Length = 117

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		226
KOG3077		260	consensus Uncharacterized conserved protein [Funct	100.0
PF03556		117	Cullin_binding: Cullin binding; InterPro: IPR00517	100.0
cd00051		63	EFh EF-hand, calcium binding motif; A diverse supe	94.93
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	94.26
PTZ00183		158	centrin; Provisional	94.11
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	93.89
PTZ00184		149	calmodulin; Provisional	93.83
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	93.62
cd00052		67	EH Eps15 homology domain; found in proteins implic	93.52
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	93.47
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	92.88
PTZ00183		158	centrin; Provisional	92.84
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	92.14
cd00213		88	S-100 S-100: S-100 domain, which represents the la	91.94
PTZ00184		149	calmodulin; Provisional	91.02
KOG3077		260	consensus Uncharacterized conserved protein [Funct	90.46
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	89.99
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	89.74
KOG0036		463	consensus Predicted mitochondrial carrier protein	89.42
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	87.91
KOG0027		151	consensus Calmodulin and related proteins (EF-Hand	87.71
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	84.47
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	84.3
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	84.12
PF09279		83	EF-hand_like: Phosphoinositide-specific phospholip	84.1
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	83.14
TIGR01446		73	DnaD_dom DnaD and phage-associated domain. This mo	81.7

>KOG3077 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Probab=100.00  E-value=2.8e-65  Score=448.92  Aligned_cols=222  Identities=33%  Similarity=0.622  Sum_probs=197.8

Q ss_pred             CCCccccccCCCCCch--------h-hHHHhhCC------CCCChhhHHHHHHHHHHhcCCCC-CCCCHHHHHHHHHhhC
Q 027201            1 MRRSVSRKTGQTNSTD--------A-TDLFRSAS------SKASSKEMERIDNLFYSYANKSS-GMIDPEGIESLCSDIE   64 (226)
Q Consensus         1 ~~~~~~~~~~~~~~~~--------A-~d~~~~~~------~~~~~~~~~~l~~lFd~Y~d~~~-~~I~~dG~~~~~~DLg   64 (226)
                      |+-|++++..|.+.+-        | .+.||.++      +.....+..++.++|.+|+|+.+ +.|++|||.+||+|||
T Consensus        16 ~~~~~~~~~~s~~~~~~~dw~~~~~~~~s~~~~~~~~~~~~~~~~~s~~~l~~~f~~y~d~~d~~~i~~dgi~~fc~dlg   95 (260)
T KOG3077|consen   16 MSFTASRKKTSLSCLAACDWNLKYAFNDSYYTNPQSLREESVQARVSEKRLEELFNQYKDPDDDNLIGPDGIEKFCEDLG   95 (260)
T ss_pred             cccccccchhhhhhhcccccccchhcccchhcchhHHHHhhhhccccHHHHHHHHHHhcCcccccccChHHHHHHHHHhC
Confidence            5566666655444222        4 33455443      22334578899999999999976 6999999999999999


Q ss_pred             CCCCcHHHHHHHHhhCcCccccccHHHHHHHhHHccCCcHHHHHHHhHHHHHHhCCcchhHHHHHhhhhhccCccccccc
Q 027201           65 VSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSV  144 (226)
Q Consensus        65 v~~ed~~~LvLa~~l~a~~~g~~tr~eF~~g~~~l~~~sl~~lk~~l~~l~~~l~~~~~Fk~~Y~ftF~~~~~~~~qk~L  144 (226)
                      |+|+|+++|||||+|+|++||+|||++|+.||.++||+|+++|+..|+.++..|.|.+.|+.||+|||+|+++ +|||+|
T Consensus        96 ~~p~~i~~LvlAwkl~A~~m~~Fsr~ef~~g~~~l~~dS~d~lq~~l~~l~~~l~d~~~Fk~iY~faf~fa~e-~~qk~L  174 (260)
T KOG3077|consen   96 VEPEDISVLVLAWKLGAATMCEFSREEFLKGMTALGCDSIDKLQQRLDFLRSVLKDLEKFKSIYRFAFNFAKE-PGQKSL  174 (260)
T ss_pred             CCchhHHHHHHHHHhccchhhhhhHHHHHHHHHHcCCCcHHHHHHHHHHHHHHHccHHHhhHHHHhhhhhccC-cCcCcC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999995 899999


Q ss_pred             cHHhHHHHHhhhhCCCChhhHHHHHHHHHhcCCCCcCChhhHHHHHHHHhhcCCCCCCCCCCCCCchhhHHHHHHHHHhh
Q 027201          145 DIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAK  224 (226)
Q Consensus       145 ~~d~Ai~~W~llf~~~~~~~l~~W~~Fl~~~~~~k~IskD~W~~~l~F~~~v~~~dls~YDe~~AWP~lIDeFVe~~r~~  224 (226)
                      ++++||.||+|||+.+++ .++.|++||.++ +++.|+||||||+|+|++++. +++|||||+||||+||||||||+|.+
T Consensus       175 d~~~ai~~w~ll~~~~~p-ll~~w~~FL~~~-~~~~~~KDtW~~~l~Fs~~i~-~dlSnYDeegAWP~liDeFVe~~r~~  251 (260)
T KOG3077|consen  175 DLETAISLWKLLFGQTPP-LLDQWIQFLKDS-PNRAISKDTWNLLLDFSKTID-PDLSNYDEEGAWPVLIDEFVEYLRDK  251 (260)
T ss_pred             CHHHHHHHHHHHhCCCCc-hHHHHHHHHHhC-cCcccCcccHHHHHHHHHhcC-ccccCccccccchHHHHHHHHHHHHh
Confidence            999999999999988875 899999999974 678999999999999999986 99999999999999999999999988


Q ss_pred             CC
Q 027201          225 QT  226 (226)
Q Consensus       225 ~~  226 (226)
                      ++
T Consensus       252 ~~  253 (260)
T KOG3077|consen  252 QS  253 (260)
T ss_pred             cc
Confidence            63

>PF03556 Cullin_binding: Cullin binding; InterPro: IPR005176 The eukaryotic defective in cullin neddylation (DCN) protein family, may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes	Back alignment and domain information

>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>KOG3077 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>TIGR01446 DnaD_dom DnaD and phage-associated domain	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		226
3kev_A		199	X-Ray Crystal Structure Of A Dcun1 Domain-Containin		6e-28
4gba_A		221	Dcnl Complex With N-terminally Acetylated Nedd8 E2		5e-26
3tdu_A		200	N-Terminal Acetylation Acts As An Avidity Enhancer		1e-22
4gao_A		200	Dcnl Complex With N-terminally Acetylated Nedd8 E2		1e-21

>pdb|3KEV|A Chain A, X-Ray Crystal Structure Of A Dcun1 Domain-Containing Protein From Galdieria Sulfuraria Length = 199

Back alignment and structure

Iteration: 1

Score = 120 bits (301), Expect = 6e-28, Method: Compositional matrix adjust. Identities = 69/190 (36%), Positives = 113/190 (59%), Gaps = 5/190 (2%) Query: 36 IDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRG 95 I LF +Y I EG++ L DI+V +DV L+LAWK+KA F+ +E+ G Sbjct: 9 ILELFQTYKEPLGNYIGAEGLQRLFEDIQVDPSDVVTLVLAWKLKASSTXEFSEKEFVEG 68 Query: 96 LKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGL 155 L L+ D++ KLK+ L L KE++ P+ F+ FY F F+Y E Q+S+ E+ L + Sbjct: 69 LANLQVDSLEKLKRKLSSLRKEIEDPSKFRAFYQFVFQYS-KEPSQRSLPAETAXALWDV 127 Query: 156 VLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLD 215 +L ++ + +D +E+LK ++ I+ D W Y F ++S D ++YD N AWP+++D Sbjct: 128 LLRGRF-SLLDSWLEFLK--NNTHSISRDTWNLLYDFS-QLSEKDLSDYDENGAWPVLID 183 Query: 216 NFVEWMKAKQ 225 +FV+W+K +Q Sbjct: 184 DFVKWLKHEQ 193

PyMOL of 3kev

>pdb|4GBA|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 221

Back alignment and structure

>pdb|3TDU|A Chain A, N-Terminal Acetylation Acts As An Avidity Enhancer Within An Interconnected Multiprotein Complex: Structure Of A Human Cul1whb- Dcn1p-Acetylated Ubc12n Complex Length = 200

Back alignment and structure

>pdb|4GAO|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 200

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		226
3kev_A		199	Galieria sulfuraria DCUN1 domain-containing prote;	2e-62
3tdu_A		200	DCN1-like protein 1; E2:E3, ligase-protein binding	2e-58
3bq3_A		270	Defective in cullin neddylation protein 1; ubiquit	1e-48
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-04

>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Length = 199	Back alignment and structure

 Score =  192 bits (490), Expect = 2e-62
 Identities = 67/198 (33%), Positives = 112/198 (56%), Gaps = 5/198 (2%)

Query: 28  ASSKEMERIDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYF 87
           +   + + I  LF +Y       I  EG++ L  DI+V  +DV  L+LAWK+KA     F
Sbjct: 1   SKRADKKAILELFQTYKEPLGNYIGAEGLQRLFEDIQVDPSDVVTLVLAWKLKASSTCEF 60

Query: 88  TLEEWRRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIE 147
           + +E+  GL  L+ D++ KLK+ L  L KE++ P+ F+ FY F F+Y   E  Q+S+  E
Sbjct: 61  SEKEFVEGLANLQVDSLEKLKRKLSSLRKEIEDPSKFRAFYQFVFQYSK-EPSQRSLPAE 119

Query: 148 SVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPN 207
           +   L  ++L  ++   +D  +E+L  +++   I+ D W   Y F       D ++YD N
Sbjct: 120 TAMALWDVLLRGRFS-LLDSWLEFL--KNNTHSISRDTWNLLYDFSQLSE-KDLSDYDEN 175

Query: 208 LAWPLVLDNFVEWMKAKQ 225
            AWP+++D+FV+W+K +Q
Sbjct: 176 GAWPVLIDDFVKWLKHEQ 193

PyMOL of 3kev

>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A Length = 200	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		226
3kev_A		199	Galieria sulfuraria DCUN1 domain-containing prote;	100.0
3tdu_A		200	DCN1-like protein 1; E2:E3, ligase-protein binding	100.0
4gba_A		221	DCN1-like protein 3; E3 ligase, ligase-peptide com	100.0
3bq3_A		270	Defective in cullin neddylation protein 1; ubiquit	100.0
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	97.01
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	96.96
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	96.84
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	96.76
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	96.69
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	96.63
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	96.63
3fwb_A		161	Cell division control protein 31; gene gating, com	96.61
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	96.6
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	96.57
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	96.55
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	96.54
2jnf_A		158	Troponin C; stretch activated muscle contraction,	96.54
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	96.53
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	96.44
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	96.34
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	96.33
1y1x_A		191	Leishmania major homolog of programmed cell death	96.32
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	96.32
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	96.3
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	96.28
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	96.13
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	96.09
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	96.02
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	95.94
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	95.81
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	95.76
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	95.74
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	95.7
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	95.69
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	95.68
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	95.67
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	95.63
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	95.59
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	95.56
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	95.46
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	95.42
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	95.32
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	95.3
3li6_A		66	Calcium-binding protein; calcium signaling protein	95.29
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	95.28
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	95.23
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	95.21
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	95.2
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	95.16
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	95.15
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	95.1
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	95.09
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	95.08
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	95.03
3fwb_A		161	Cell division control protein 31; gene gating, com	94.99
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	94.95
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	94.95
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	94.95
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	94.9
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	94.89
1y1x_A		191	Leishmania major homolog of programmed cell death	94.81
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	94.79
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	94.79
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	94.7
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	94.69
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	94.69
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	94.68
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	94.65
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	94.64
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	94.59
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	94.55
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	94.53
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	94.53
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	94.53
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	94.5
1c07_A		95	Protein (epidermal growth factor receptor pathway	94.45
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	94.37
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	94.34
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	94.32
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	94.31
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	94.3
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	94.2
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	94.04
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	94.0
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	93.99
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	93.99
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	93.97
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	93.93
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	93.86
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	93.85
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	93.83
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	93.79
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	93.78
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	93.71
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	93.69
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	93.68
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	93.67
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	93.58
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	93.56
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	93.56
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	93.55
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	93.52
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	93.48
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	93.47
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	93.44
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	93.43
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	93.38
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	93.35
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	93.32
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	93.31
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	93.23
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	93.18
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	93.12
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	93.07
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	93.07
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	93.04
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	93.03
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	93.02
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	92.98
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	92.9
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	92.85
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	92.81
3fia_A		121	Intersectin-1; EH 1 domain, NESG, structural genom	92.81
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	92.75
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	92.74
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	92.72
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	92.71
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	92.71
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	92.64
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	92.63
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	92.62
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	92.58
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	92.52
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	92.5
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	92.42
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	92.39
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	92.34
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	92.21
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	92.13
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	92.12
2jnf_A		158	Troponin C; stretch activated muscle contraction,	92.1
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	92.08
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	91.99
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	91.97
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	91.92
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	91.87
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	91.61
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	91.6
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	91.58
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	91.48
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	91.43
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	91.38
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	91.22
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	91.15
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	91.12
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	91.11
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	91.06
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	90.91
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	90.83
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	90.83
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	90.65
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	90.61
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	90.5
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	90.48
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	90.4
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	90.3
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	90.28
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	90.18
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	89.92
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	89.79
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	89.74
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	89.72
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	89.7
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	89.58
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	89.41
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	89.18
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	89.03
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	88.97
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	88.95
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	88.88
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	88.56
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	88.55
2jq6_A		139	EH domain-containing protein 1; metal binding prot	88.54
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	88.26
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	88.25
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	88.24
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	88.15
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	88.13
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	88.06
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	87.96
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	87.72
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	87.46
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	87.21
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	86.86
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	86.57
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	86.45
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	86.43
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	86.28
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	86.07
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	86.01
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	86.0
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	85.88
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	85.84
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	85.83
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	85.31
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	85.25
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	85.19
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	84.39
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	84.18
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	84.15
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	83.76
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	83.62
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	83.3
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	83.24
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	82.96
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	82.87
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	82.8
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	82.72
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	82.51
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	82.5
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	82.39
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	82.22
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	81.51
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	81.49
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	81.21
2hps_A		186	Coelenterazine-binding protein with bound coelent;	80.55
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	80.23
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	80.13
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	80.1

>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria}	Back alignment and structure

Probab=100.00  E-value=1.4e-75  Score=499.72  Aligned_cols=190  Identities=35%  Similarity=0.680  Sum_probs=177.7

Q ss_pred             hhHHHHHHHHHHhcCCCCCCCCHHHHHHHHHhhCCCCCcHHHHHHHHhhCcCccccccHHHHHHHhHHccCCcHHHHHHH
Q 027201           31 KEMERIDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKA  110 (226)
Q Consensus        31 ~~~~~l~~lFd~Y~d~~~~~I~~dG~~~~~~DLgv~~ed~~~LvLa~~l~a~~~g~~tr~eF~~g~~~l~~~sl~~lk~~  110 (226)
                      .+.++|+++|++|++++++.||++|+++||+||||+|||+++|||||+|+|++||+|||+||++||+++||+|+++||++
T Consensus         4 ~~~~~l~~lF~~Y~d~~~~~I~~dG~~~~~~DLgv~ped~~~LvLaw~l~a~~~g~ftr~ef~~G~~~l~~dsi~~lk~~   83 (199)
T 3kev_A            4 ADKKAILELFQTYKEPLGNYIGAEGLQRLFEDIQVDPSDVVTLVLAWKLKASSTCEFSEKEFVEGLANLQVDSLEKLKRK   83 (199)
T ss_dssp             CCHHHHHHHHHHHCCTTSSEECHHHHHHHHHHTTCCTTSHHHHHHHHHTTCCSTTCEEHHHHHHHHHHTTCCSHHHHHHH
T ss_pred             cCHHHHHHHHHHhcCCCcCccCHHHHHHHHHHcCCChhhHHHHHHHHHcCCCccCcccHHHHHHHHHHhCCCCHHHHHHH
Confidence            47889999999999987679999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHhCCcchhHHHHHhhhhhccCccccccccHHhHHHHHhhhhCCCChhhHHHHHHHHHhcCCCCcCChhhHHHHH
Q 027201          111 LPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFY  190 (226)
Q Consensus       111 l~~l~~~l~~~~~Fk~~Y~ftF~~~~~~~~qk~L~~d~Ai~~W~llf~~~~~~~l~~W~~Fl~~~~~~k~IskD~W~~~l  190 (226)
                      |++|+++|+|+.+||+||+|||+|+|+ +|||+|++|+||+||+|||+++|+ +++.|++||+++ + |+||||||+|+|
T Consensus        84 l~~l~~~l~d~~~Fk~~Y~ftF~~~re-~gqk~L~~e~Ai~~W~lll~~~~~-~l~~W~~FL~~~-~-k~IskD~W~~~l  159 (199)
T 3kev_A           84 LSSLRKEIEDPSKFRAFYQFVFQYSKE-PSQRSLPAETAMALWDVLLRGRFS-LLDSWLEFLKNN-T-HSISRDTWNLLY  159 (199)
T ss_dssp             HHHHHHHTTSHHHHHHHHHHHHHHHSC-TTCSSBCHHHHHHHHHHHHTTTCT-THHHHHHHGGGC-C-SCBCHHHHHHHH
T ss_pred             HHHHHHHccCHHHHHHHHHHHHHHHcC-cCcCCCCHHHHHHHHHHHhCCccH-HHHHHHHHHHhc-C-CCcCHHHHHHHH
Confidence            999999999999999999999999996 799999999999999999999995 999999999864 4 999999999999


Q ss_pred             HHHhhcCCCCCCCCCCCCCchhhHHHHHHHHHhhC
Q 027201          191 RFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAKQ  225 (226)
Q Consensus       191 ~F~~~v~~~dls~YDe~~AWP~lIDeFVe~~r~~~  225 (226)
                      +|+++|+ +++|+|||+||||+||||||||+|+++
T Consensus       160 ~F~~~i~-~dls~YDe~gAWP~liDeFVe~~r~~~  193 (199)
T 3kev_A          160 DFSQLSE-KDLSDYDENGAWPVLIDDFVKWLKHEQ  193 (199)
T ss_dssp             HHHTC---CTTTTCC---CCCHHHHHHHHHHTTC-
T ss_pred             HHHHHhc-ccccCCCCCCCchHHHHHHHHHHHHcC
Confidence            9999996 999999999999999999999999885

PyMOL of 3kev

>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A*	Back alignment and structure

>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens}	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		226
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	96.76
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	96.61
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	96.55
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	96.42
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	96.41
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	96.35
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	96.22
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	96.17
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	96.06
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	95.96
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	95.89
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	95.8
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	95.77
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	95.59
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	95.39
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	95.37
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	94.87
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	94.57
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	94.56
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	94.44
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	94.43
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	94.23
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	93.86
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	93.8
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	93.73
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	93.73
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	93.67
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	93.63
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	93.42
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	93.36
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	93.28
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	93.14
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	92.92
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	92.68
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	92.64
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	92.4
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	92.3
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	92.21
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	92.19
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	92.18
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	92.09
d1qjta_		99	Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	91.92
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	91.68
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	91.66
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	91.31
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	91.08
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	91.08
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	91.0
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	90.94
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	90.85
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	90.73
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	90.67
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	90.61
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	90.36
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	90.31
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	90.26
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	90.21
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	89.64
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	89.63
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	89.24
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	89.24
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	89.23
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	89.08
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	89.01
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	88.94
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	88.18
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	88.16
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	87.49
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	86.07
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	85.77
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	85.37
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	84.73
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	84.28
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	84.14
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	83.9
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	83.67
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	83.01
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	82.72
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	81.96
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	80.48

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Polcalcin
domain: Polcalcin Che a 3
species: Pigweed (Chenopodium album) [TaxId: 3559]

Probab=96.76  E-value=0.0047  Score=42.29  Aligned_cols=69  Identities=12%  Similarity=0.287  Sum_probs=58.6

Q ss_pred             hhhHHHHHHHHHHhcCCCCCCCCHHHHHHHHHhhCCCCCcHHHHHHHHhhCcCccccccHHHHHHHhHHc
Q 027201           30 SKEMERIDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKAL   99 (226)
Q Consensus        30 ~~~~~~l~~lFd~Y~d~~~~~I~~dG~~~~~~DLgv~~ed~~~LvLa~~l~a~~~g~~tr~eF~~g~~~l   99 (226)
                      +...+.+.++|+.|=...++.|+.+-+.+.+..|| .|..-.+--+.-.+....-|.|+.+||+..|+..
T Consensus         2 ~ee~~e~~~~F~~~D~d~~G~I~~~El~~~l~~lg-~~~~~ei~~~~~~~D~d~~G~I~~~EF~~~~~~~   70 (81)
T d2opoa1           2 PQDIADRERIFKRFDTNGDGKISSSELGDALKTLG-SVTPDEVRRMMAEIDTDGDGFISFDEFTDFARAN   70 (81)
T ss_dssp             HHHHHHHHHHHHHHCTTCSSEEEHHHHHHHHHTTT-TCCHHHHHHHHHHHCTTCSSEECHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCcHHHHHHHHHHhh-cCCHHHHHHHHHHhCCCCCCeEeHHHHHHHHHHC
Confidence            45778899999999766668999999999999999 5666677777778888889999999999987663

PyMOL of d2opoa1

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure