Citrus Sinensis ID: 027215


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MSSSTPAALSPDHLSSSEQLCYVHCTFCDTVLAVPYHFIFSVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAANQLHLGHPFFTPQNLLEEIRNVPANMLMINPPNPADQSVMPVRVVDHQEIPKSPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPSDQPVKKTSVRQQQEGEDAMIKDGFFAPAANVGVTPY
cccccccccccccccccccEEEEEcccccEEEEccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccc
***************SSEQLCYVHCTFCDTVLAVPYHFIFSVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAANQ*********************************************************************RFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM*************************FFAPAANVGVTP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSTPAALSPDHLSSSEQLCYVHCTFCDTVLAVPYHFIFSVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAANQLHLGHPFFTPQNLLEEIRNVPANMLMINPPNPADQSVMPVRVVDHQEIPKSPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPSDQPVKKTSVRQQQEGEDAMIKDGFFAPAANVGVTPY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein YABBY 5 May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination.probableQ0JBF0
Axial regulator YABBY 1 Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box.probableO22152
Protein YABBY 5 May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination.probableQ01JG2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YRQ, chain A
Confidence level:confident
Coverage over the Query: 134-181
View the alignment between query and template
View the model in PyMOL