BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027216
         (226 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q4G346|RR9_EMIHU 30S ribosomal protein S9, chloroplastic OS=Emiliania huxleyi
           GN=rps9 PE=3 SV=1
          Length = 131

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%)

Query: 68  LITVSPSDGRWHGNWNSEYVVSLKQLRLADLIEDDDHLH 106
           +ITV+   G  + N+NSEY+ +L+   LA  +E+D  LH
Sbjct: 27  IITVNKKPGETYFNYNSEYLSTLRGPLLALGLENDYDLH 65


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.318    0.132    0.387 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 77,826,571
Number of Sequences: 539616
Number of extensions: 2999359
Number of successful extensions: 7440
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 7437
Number of HSP's gapped (non-prelim): 3
length of query: 226
length of database: 191,569,459
effective HSP length: 113
effective length of query: 113
effective length of database: 130,592,851
effective search space: 14756992163
effective search space used: 14756992163
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)