Citrus Sinensis ID: 027220


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MTADGGNQLISVHPEELKFIFELEKQGFCDLKVINNTEHHVAFKVKTTSPKKYFVRPNTGVVQPWDSCIIRVTLQAQRESPPDMQCKDKFLLQSTIVPSNTDVDDLPPDTFNKDSGKTIEECKLRVVYVSPSSAQGNLEDEGLVSATRSPDANSALQRLKDERDAAVRQTQLLQQDLDMLKRRGQRKGVRGFSLMFAAFVGLIGIMVGLILNLLLSSPPPTVPQND
cccccccccEEEcccEEEEEcccccEEEEEEEEEcccccEEEEEEEcccccEEEEcccccEEccccCEEEEEEECcccccccccccccCEEEEEEEEcccccccccccccccccccccEEEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
******N**ISVHPEELKFIFELEKQGFCDLKVINNTEHHVAFKVKTTSPKKYFVRPNTGVVQPWDSCIIRVTLQAQRESPPDMQCKDKFLLQSTIVPSNTDVDDLP******D***TIEECKLRVVYV*********************************************************KGVRGFSLMFAAFVGLIGIMVGLILNLLL***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTADGGNQLISVHPEELKFIFELEKQGFCDLKVINNTEHHVAFKVKTTSPKKYFVRPNTGVVQPWDSCIIRVTLQAQRESPPDMQCKDKFLLQSTIVPSNTDVDDLPPDTFNKDSGKTIEECKLRVVYVSPSSAQGNLEDEGLVSATRSPDANSAxxxxxxxxxxxxxxxxxxxxxxxxxxxxGQRKGVRGFSLMFAAFVGLIGIMVGLILNLLLSSPPPTVPQND

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle-associated protein 2-1 May play a role in vesicle trafficking.probableQ9LVU1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CRI, chain A
Confidence level:very confident
Coverage over the Query: 6-136
View the alignment between query and template
View the model in PyMOL
Template: 3M48, chain A
Confidence level:probable
Coverage over the Query: 157-184
View the alignment between query and template
View the model in PyMOL