Citrus Sinensis ID: 027225

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------

MKRLRHPNIVLFMGAVTQPPNLSIVTEYLSRGSLYRLLHKPGVREMLDERRRLNMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWGNLNPAQVVAAVGFKGKRLEIPRNVNPHVASIIEACWANEPWKRPSFSTIMELLRPLIKSPTPQPSPTDMPLLT

ccccccccEEEEEEEECccccEEEEEEccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccEEECccccccEEEcccccEEEccccccEEccccccccccccccccccccHHccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccc

MKRLRHPNIVLFMGAVTQPPNLSIVTEYLSRGSLYRLLHKPGVREMLDERRRLNMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFL*SKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWGNLNPAQVVAAVGFKGKRLEIPRNVNPHVASIIEACWANEPWKRPSFSTIMELLRPL*****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine-protein kinase CTR1	Acts as a negative regulator in the ethylene response pathway.	probable	Q05609

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P86, chain A
Confidence level:very confident
Coverage over the Query: 2-97,115-211
View the alignment between query and template
View the model in PyMOL