Citrus Sinensis ID: 027236


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MAPKSDNTEAIVLNYVNEQNRPLNSQNVADALQKYNLKKAGIQKALDSLADNGKISFKEYGKQKIYIARQDQFDIPNSEELNQMKEENAKLQEQLEEQRKAISKLEGEIRTLQSNLTLEQIREKEAQLVKEVKEMENKLAKLRGGVTLVKPEDRMAVEEMFLEKLSQWRKRKRMLRDIWDPIMENSPKNLKEFKEELGIEYDEDVGVSLQSFSDLLQRGKKPKGGR
cccccccHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHHHHccccccEEcccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccHHHHHccccccccc
******N***IVLNYVNEQNRPLNSQNVADALQKYNLKKAGIQKALDSLADNGKISFKEYGKQKIYIARQD**********************************************LEQIREKEAQLVK**********KLRGGVTLVKPEDRMAVEEMFLEKLSQWRKRKRMLRDIWDPIMENSPKNLKEFKEELGIEYDEDVGVSLQ****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPKSDNTEAIVLNYVNEQNRPLNSQNVADAxxxxxxxxxxxxxxxxxxxxxGKISFKEYGKQKIYIARQDQFDIPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVTLVKPEDRMAVEEMFLEKLSQWRKRKRMLRDIWDPIMENSPKNLKEFKEELGIEYDEDVGVSLQSFSDLLQRGKKPKGGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homologous-pairing protein 2 homolog Involved in bivalent formation and segregation of homologous chromosomes in meiosis.confidentQ9FX64
Homologous-pairing protein 2 homolog Plays an important role in meiotic recombination. Stimulates DMC1-mediated strand exchange required for pairing homologous chromosomes during meiosis. The complex PSMC3IP/MND1 binds DNA, stimulates the recombinase activity of DMC1 as well as DMC1 D-loop formation from double-strand DNA. This complex stabilizes presynaptic RAD51 and DMC1 filaments formed on single strand DNA to capture double-strand DNA. This complex stimulates both synaptic and presynaptic critical steps in RAD51 and DMC1-promoted homologous pairing. May inhibit HIV-1 viral protein TAT activity and modulate the activity of proteasomes through association with PSMC3.probableO35047
Homologous-pairing protein 2 homolog Plays an important role in meiotic recombination. Stimulates DMC1-mediated strand exchange required for pairing homologous chromosomes during meiosis. The complex PSMC3IP/MND1 binds DNA, stimulates the recombinase activity of DMC1 as well as DMC1 D-loop formation from double-strand DNA. This complex stabilizes presynaptic RAD51 and DMC1 filaments formed on single strand DNA to capture double-strand DNA. This complex stimulates both synaptic and presynaptic critical steps in RAD51 and DMC1-promoted homologous pairing. May inhibit HIV-1 viral protein TAT activity and modulate the activity of proteasomes through association with PSMC3. Acts as a tissue specific coactivator of hormone-dependent transcription mediated by nuclear receptors.probableQ9P2W1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LJ9, chain A
Confidence level:probable
Coverage over the Query: 7-90,104-143
View the alignment between query and template
View the model in PyMOL
Template: 3VIQ, chain B
Confidence level:probable
Coverage over the Query: 117-202
View the alignment between query and template
View the model in PyMOL