BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027274
         (225 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2BTZ|A Chain A, Crystal Structures Of Human Pyruvate Dehydrogenase Kinase
           2 Containing Physiological And Synthetic Ligands
 pdb|2BU2|A Chain A, Crystal Structures Of Human Pyruvate Dehydrogenase Kinase
           2 Containing Physiological And Synthetic Ligands
 pdb|2BU5|A Chain A, Crystal Structures Of Human Pyruvate Dehydrogenase Kinase
           2 Containing Physiological And Synthetic Ligands
 pdb|2BU6|A Chain A, Crystal Structures Of Human Pyruvate Dehydrogenase Kinase
           2 Containing Physiological And Synthetic Ligands
 pdb|2BU7|A Chain A, Crystal Structures Of Human Pyruvate Dehydrogenase Kinase
           2 Containing Physiological And Synthetic Ligands
 pdb|2BU8|A Chain A, Crystal Structures Of Human Pyruvate Dehydrogenase Kinase
           2 Containing Physiological And Synthetic Ligands
          Length = 394

 Score = 31.2 bits (69), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%)

Query: 153 AYVEQSIPYPQDGKQGWWSGGFGYGLWIGILVASGF 188
           +Y+  + P PQ G  G    GFGYGL I  L A  F
Sbjct: 292 SYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYF 327


>pdb|1JM6|A Chain A, Pyruvate Dehydrogenase Kinase, Isozyme 2, Containing Adp
 pdb|1JM6|B Chain B, Pyruvate Dehydrogenase Kinase, Isozyme 2, Containing Adp
 pdb|3CRK|A Chain A, Crystal Structure Of The Pdhk2-L2 Complex.
 pdb|3CRK|B Chain B, Crystal Structure Of The Pdhk2-L2 Complex.
 pdb|3CRL|A Chain A, Crystal Structure Of The Pdhk2-L2 Complex.
 pdb|3CRL|B Chain B, Crystal Structure Of The Pdhk2-L2 Complex
          Length = 407

 Score = 31.2 bits (69), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%)

Query: 153 AYVEQSIPYPQDGKQGWWSGGFGYGLWIGILVASGF 188
           +Y+  + P PQ G  G    GFGYGL I  L A  F
Sbjct: 305 SYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYF 340


>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51)
           From Leishmania Infantum In Complex With Fluconazole
 pdb|3L4D|B Chain B, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51)
           From Leishmania Infantum In Complex With Fluconazole
 pdb|3L4D|C Chain C, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51)
           From Leishmania Infantum In Complex With Fluconazole
 pdb|3L4D|D Chain D, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51)
           From Leishmania Infantum In Complex With Fluconazole
          Length = 453

 Score = 28.1 bits (61), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 109 NGCSAEVFDTPHLPVLVGKRVRKRLDAKSMIMLLRSLDA 147
           + CSA + +T     L G+ +RKRLDA+    LL  +++
Sbjct: 141 DDCSAMIINTA-CQCLFGEDLRKRLDARQFAQLLAKMES 178


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.135    0.435 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,593,944
Number of Sequences: 62578
Number of extensions: 260302
Number of successful extensions: 501
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 494
Number of HSP's gapped (non-prelim): 16
length of query: 225
length of database: 14,973,337
effective HSP length: 95
effective length of query: 130
effective length of database: 9,028,427
effective search space: 1173695510
effective search space used: 1173695510
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)