Citrus Sinensis ID: 027279


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MSASVNSSSATVNKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRYVIFLKRIFYVESKPLLFIIFQFEVYTSLPVCHCGQAMMQRFEVLIAFF
cccccccccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHccccccccccccEEEEEEEcccccccccccccEEEEEEEEEEccccEEEEEEccccccccccEEcccEEccccccHHHHHHHHHHHHcccEEEEEEEEEEEEEEEEcEEEEEccccEEEEEEEEEEcccEEcccccHHHHHHHHHHHccc
cccHccccccccccEEcccccccccEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHHHcccEEEcccccEEEEEEEcccccccccccccEEEEEEEEEEEcccEEEEEEEccccccccccEEccEEEccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEcccEEEEEEEccccccccHHcHHHHHHHHHHHHHHc
msasvnssSATVNKFLNgindnyggvvvqmnepmdPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLvepavkegfwfhhaepnYLMLVYWipggantlpanashrvGVGAFVMNGKREVLVVQensgrfrgtgiwkfptgvvdegeDICVAAVREVKEETSIDTEFVEVLAFRYVIFLKRIFYVESKPLLFIIFQFEvytslpvchcgQAMMQRFEVLIAFF
msasvnssSATVNKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVqensgrfrgtgiwkfptgvvdegEDICVAAVREvkeetsidtefveVLAFRYVIFLKRIFYVESKPLLFIIFQFEVYTSLPVCHCGQAMMQRFEVLIAFF
MsasvnsssatvnKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRYVIFLKRIFYVESKPLLFIIFQFEVYTSLPVCHCGQAMMQRFEVLIAFF
***********VNKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRYVIFLKRIFYVESKPLLFIIFQFEVYTSLPVCHCGQAMMQRFEVLIAF*
***************LNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRYVIFLKRIFYVESKPLLFIIFQFEVYTSLPVCHCGQAMMQRFEVLIAFF
**********TVNKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRYVIFLKRIFYVESKPLLFIIFQFEVYTSLPVCHCGQAMMQRFEVLIAFF
***********VNKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRYVIFLKRIFYVESKPLLFIIFQFEVYTSLPVCHCGQAMMQRFEVLIAFF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSASVNSSSATVNKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRYVIFLKRIFYVESKPLLFIIFQFEVYTSLPVCHCGQAMMQRFEVLIAFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
Q94B74278 Nudix hydrolase 2 OS=Arab yes no 0.782 0.633 0.65 1e-64
Q9SU14282 Nudix hydrolase 7 OS=Arab no no 0.72 0.574 0.613 1e-53
Q6NPD7277 Nudix hydrolase 10 OS=Ara no no 0.675 0.548 0.617 5e-53
Q8L7W2369 Nudix hydrolase 8 OS=Arab no no 0.786 0.479 0.536 2e-49
Q9SJC4283 Nudix hydrolase 6 OS=Arab no no 0.822 0.653 0.531 4e-49
Q9SJC6302 Nudix hydrolase 5 OS=Arab no no 0.715 0.533 0.558 4e-48
P70563313 Nucleoside diphosphate-li yes no 0.702 0.504 0.389 1e-27
Q8CH40313 Nucleoside diphosphate-li yes no 0.702 0.504 0.389 2e-27
P53370316 Nucleoside diphosphate-li yes no 0.702 0.5 0.389 3e-26
P13420217 Nucleoside diphosphate-li N/A no 0.555 0.576 0.435 7e-20
>sp|Q94B74|NUDT2_ARATH Nudix hydrolase 2 OS=Arabidopsis thaliana GN=NUDT2 PE=1 SV=1 Back     alignment and function desciption
 Score =  245 bits (626), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 138/180 (76%), Gaps = 4/180 (2%)

Query: 1   MSASVNS----SSATVNKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKK 56
           MSAS +S    S       L  + D YGGV+ +M  PMDP LF++LL+SS+S W  Q KK
Sbjct: 1   MSASSSSTNPMSREDATTLLPSVQDKYGGVMTEMTHPMDPSLFSTLLRSSLSTWTLQGKK 60

Query: 57  GVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVM 116
           GVWIKLP +L  L E AVKEGFWFHHAE +YLMLVYWIP   +TLPANASHRVG+GAFV+
Sbjct: 61  GVWIKLPKQLIGLAETAVKEGFWFHHAEKDYLMLVYWIPKEDDTLPANASHRVGIGAFVI 120

Query: 117 NGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFR 176
           N  +EVLVVQE +GRF+G GIWKFPTGVV+EGEDI   +VREVKEET +DTEF ++LAFR
Sbjct: 121 NHNKEVLVVQEKTGRFQGQGIWKFPTGVVNEGEDIHDGSVREVKEETGVDTEFDQILAFR 180




Probably mediates the hydrolysis of some nucleoside diphosphate derivatives. In vitro, it can use both NADH and ADP-ribose as substrates; however the relevance of such substrates in vivo is unclear.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 2EC: 2
>sp|Q9SU14|NUDT7_ARATH Nudix hydrolase 7 OS=Arabidopsis thaliana GN=NUDT7 PE=1 SV=1 Back     alignment and function description
>sp|Q6NPD7|NUD10_ARATH Nudix hydrolase 10 OS=Arabidopsis thaliana GN=NUDT10 PE=1 SV=1 Back     alignment and function description
>sp|Q8L7W2|NUDT8_ARATH Nudix hydrolase 8 OS=Arabidopsis thaliana GN=NUDT8 PE=2 SV=2 Back     alignment and function description
>sp|Q9SJC4|NUDT6_ARATH Nudix hydrolase 6 OS=Arabidopsis thaliana GN=NUDT6 PE=1 SV=1 Back     alignment and function description
>sp|Q9SJC6|NUDT5_ARATH Nudix hydrolase 5 OS=Arabidopsis thaliana GN=NUDT5 PE=2 SV=3 Back     alignment and function description
>sp|P70563|NUDT6_RAT Nucleoside diphosphate-linked moiety X motif 6 OS=Rattus norvegicus GN=Nudt6 PE=1 SV=1 Back     alignment and function description
>sp|Q8CH40|NUDT6_MOUSE Nucleoside diphosphate-linked moiety X motif 6 OS=Mus musculus GN=Nudt6 PE=2 SV=1 Back     alignment and function description
>sp|P53370|NUDT6_HUMAN Nucleoside diphosphate-linked moiety X motif 6 OS=Homo sapiens GN=NUDT6 PE=1 SV=2 Back     alignment and function description
>sp|P13420|NUDT6_XENLA Nucleoside diphosphate-linked moiety X motif 6 OS=Xenopus laevis GN=nudt6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
224086336241 predicted protein [Populus trichocarpa] 0.724 0.676 0.766 1e-72
297735882253 unnamed protein product [Vitis vinifera] 0.795 0.707 0.726 4e-71
388505352301 unknown [Lotus japonicus] 0.848 0.634 0.628 7e-70
147828008 346 hypothetical protein VITISV_029203 [Viti 0.773 0.502 0.735 8e-70
359496122274 PREDICTED: nudix hydrolase 2-like [Vitis 0.786 0.645 0.711 3e-69
356532784 338 PREDICTED: nudix hydrolase 2-like [Glyci 0.782 0.520 0.651 1e-68
224137208277 predicted protein [Populus trichocarpa] 0.72 0.584 0.734 2e-68
255579168285 mutt domain protein, putative [Ricinus c 0.782 0.617 0.672 2e-68
296085037 355 unnamed protein product [Vitis vinifera] 0.862 0.546 0.634 4e-68
356555765 338 PREDICTED: nudix hydrolase 2-like [Glyci 0.72 0.479 0.722 5e-68
>gi|224086336|ref|XP_002307853.1| predicted protein [Populus trichocarpa] gi|222853829|gb|EEE91376.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 125/163 (76%), Positives = 147/163 (90%)

Query: 14  KFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPA 73
           + L+ +ND++GGV+V+++E MD ++FAS+LK+S++ WR Q K+GVWIK+PIEL NLVE A
Sbjct: 76  RLLDSVNDDHGGVIVELSESMDSKVFASMLKASLALWRSQGKRGVWIKVPIELVNLVEAA 135

Query: 74  VKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFR 133
           VKEGFWFHHAEP YLML +WIP GA+TLPANASHRVGVGAFVMN KREVLVVQE SG FR
Sbjct: 136 VKEGFWFHHAEPKYLMLAFWIPEGAHTLPANASHRVGVGAFVMNKKREVLVVQEKSGLFR 195

Query: 134 GTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFR 176
           GTG+WKFPTGVVDEGEDIC AA+REVKEET+IDTEFVEVLAFR
Sbjct: 196 GTGVWKFPTGVVDEGEDICAAAMREVKEETAIDTEFVEVLAFR 238




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297735882|emb|CBI18641.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388505352|gb|AFK40742.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|147828008|emb|CAN70796.1| hypothetical protein VITISV_029203 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496122|ref|XP_002270110.2| PREDICTED: nudix hydrolase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532784|ref|XP_003534950.1| PREDICTED: nudix hydrolase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|224137208|ref|XP_002322500.1| predicted protein [Populus trichocarpa] gi|222867130|gb|EEF04261.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255579168|ref|XP_002530431.1| mutt domain protein, putative [Ricinus communis] gi|223530039|gb|EEF31962.1| mutt domain protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296085037|emb|CBI28452.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356555765|ref|XP_003546200.1| PREDICTED: nudix hydrolase 2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
TAIR|locus:2168993278 NUDT2 "nudix hydrolase homolog 0.915 0.741 0.578 9.3e-59
TAIR|locus:2058334283 NUDT6 "nudix hydrolase homolog 0.804 0.639 0.553 5.4e-47
TAIR|locus:2171544369 NUDT8 "nudix hydrolase homolog 0.764 0.466 0.544 2.3e-46
TAIR|locus:2058364302 NUDT5 "nudix hydrolase homolog 0.711 0.529 0.555 1.6e-45
TAIR|locus:2058349215 AT2G04440 "AT2G04440" [Arabido 0.6 0.627 0.518 9.5e-34
DICTYBASE|DDB_G0281219376 DDB_G0281219 "Nucleoside dipho 0.697 0.417 0.390 8.2e-28
UNIPROTKB|F1RQN4314 NUDT6 "Uncharacterized protein 0.791 0.566 0.382 9.4e-27
RGD|621356313 Nudt6 "nudix (nucleoside dipho 0.702 0.504 0.389 1.9e-26
MGI|MGI:2387618313 Nudt6 "nudix (nucleoside dipho 0.702 0.504 0.389 3.2e-26
UNIPROTKB|F1NLN3297 F1NLN3 "Uncharacterized protei 0.68 0.515 0.407 1.4e-25
TAIR|locus:2168993 NUDT2 "nudix hydrolase homolog 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 603 (217.3 bits), Expect = 9.3e-59, P = 9.3e-59
 Identities = 125/216 (57%), Positives = 153/216 (70%)

Query:    16 LNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVK 75
             L  + D YGGV+ +M  PMDP LF++LL+SS+S W  Q KKGVWIKLP +L  L E AVK
Sbjct:    20 LPSVQDKYGGVMTEMTHPMDPSLFSTLLRSSLSTWTLQGKKGVWIKLPKQLIGLAETAVK 79

Query:    76 EGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGT 135
             EGFWFHHAE +YLMLVYWIP   +TLPANASHRVG+GAFV+N  +EVLVVQE +GRF+G 
Sbjct:    80 EGFWFHHAEKDYLMLVYWIPKEDDTLPANASHRVGIGAFVINHNKEVLVVQEKTGRFQGQ 139

Query:   136 GIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRYV---IFLKR-IFYV-ESK 190
             GIWKFPTGVV+EGEDI   +VREVKEET +DTEF ++LAFR      F K  +F+V   K
Sbjct:   140 GIWKFPTGVVNEGEDIHDGSVREVKEETGVDTEFDQILAFRQTHKAFFGKSDLFFVCMLK 199

Query:   191 PLLFII----FQFEVYTSLP-VCHCGQAMMQRFEVL 221
             PL   I     + E    +P   +  Q  +Q +E+L
Sbjct:   200 PLSLEINAQESEIEAAQWMPWEEYINQPFVQNYELL 235




GO:0016787 "hydrolase activity" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=RCA
GO:0047631 "ADP-ribose diphosphatase activity" evidence=IDA
GO:0051287 "NAD binding" evidence=IDA
GO:0006979 "response to oxidative stress" evidence=IMP
TAIR|locus:2058334 NUDT6 "nudix hydrolase homolog 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171544 NUDT8 "nudix hydrolase homolog 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058364 NUDT5 "nudix hydrolase homolog 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058349 AT2G04440 "AT2G04440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281219 DDB_G0281219 "Nucleoside diphosphate-linked moiety X motif 6" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQN4 NUDT6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|621356 Nudt6 "nudix (nucleoside diphosphate linked moiety X)-type motif 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2387618 Nudt6 "nudix (nucleoside diphosphate linked moiety X)-type motif 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLN3 F1NLN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94B74NUDT2_ARATH3, ., 6, ., 1, ., 2, 20.650.78220.6330yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.10.921
3rd Layer3.6.1.130.914
3rd Layer3.6.1.220.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
cd04670127 cd04670, Nudix_Hydrolase_12, Members of the Nudix 6e-33
pfam00293133 pfam00293, NUDIX, NUDIX domain 3e-15
cd03671147 cd03671, Ap4A_hydrolase_plant_like, Diadenosine te 8e-14
cd02883123 cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup 3e-13
PRK00714156 PRK00714, PRK00714, RNA pyrophosphohydrolase; Revi 6e-12
cd04676129 cd04676, Nudix_Hydrolase_17, Members of the Nudix 3e-11
cd04678129 cd04678, Nudix_Hydrolase_19, Members of the Nudix 4e-11
cd04671123 cd04671, Nudix_Hydrolase_13, Members of the Nudix 6e-11
cd03673131 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate 5e-10
COG1051145 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucl 2e-09
cd04673122 cd04673, Nudix_Hydrolase_15, Members of the Nudix 4e-09
cd03428130 cd03428, Ap4A_hydrolase_human_like, Diadenosine te 3e-08
cd04680120 cd04680, Nudix_Hydrolase_21, Members of the Nudix 4e-08
cd04672123 cd04672, Nudix_Hydrolase_14, Members of the Nudix 1e-07
cd04700142 cd04700, DR1025_like, DR1025 from Deinococcus radi 2e-07
cd03424137 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase 3e-07
cd04679125 cd04679, Nudix_Hydrolase_20, Members of the Nudix 6e-07
cd03425124 cd03425, MutT_pyrophosphohydrolase, The MutT pyrop 2e-06
cd04677132 cd04677, Nudix_Hydrolase_18, Members of the Nudix 2e-06
cd03672145 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), t 2e-06
cd04681130 cd04681, Nudix_Hydrolase_22, Members of the Nudix 2e-06
cd04690118 cd04690, Nudix_Hydrolase_31, Members of the Nudix 4e-06
cd04699129 cd04699, Nudix_Hydrolase_39, Members of the Nudix 7e-06
COG0494161 COG0494, MutT, NTP pyrophosphohydrolases including 8e-06
cd04684128 cd04684, Nudix_Hydrolase_25, Contains a crystal st 1e-05
cd03675134 cd03675, Nudix_Hydrolase_2, Contains a crystal str 2e-05
cd04665118 cd04665, Nudix_Hydrolase_8, Members of the Nudix h 3e-05
PLN02325144 PLN02325, PLN02325, nudix hydrolase 4e-05
cd03427137 cd03427, MTH1, MutT homolog-1 (MTH1) is a member o 4e-05
cd04674118 cd04674, Nudix_Hydrolase_16, Members of the Nudix 1e-04
cd04696125 cd04696, Nudix_Hydrolase_37, Members of the Nudix 1e-04
PRK09438148 PRK09438, nudB, dihydroneopterin triphosphate pyro 2e-04
cd04683120 cd04683, Nudix_Hydrolase_24, Members of the Nudix 3e-04
PRK08999 312 PRK08999, PRK08999, hypothetical protein; Provisio 5e-04
cd03674138 cd03674, Nudix_Hydrolase_1, Members of the Nudix h 5e-04
cd04669121 cd04669, Nudix_Hydrolase_11, Members of the Nudix 6e-04
cd04664129 cd04664, Nudix_Hydrolase_7, Members of the Nudix h 6e-04
cd04686131 cd04686, Nudix_Hydrolase_27, Members of the Nudix 7e-04
PRK05379340 PRK05379, PRK05379, bifunctional nicotinamide mono 8e-04
cd04688126 cd04688, Nudix_Hydrolase_29, Members of the Nudix 0.001
PRK10776129 PRK10776, PRK10776, nucleoside triphosphate pyroph 0.002
TIGR02705156 TIGR02705, nudix_YtkD, nucleoside triphosphatase Y 0.002
cd04667112 cd04667, Nudix_Hydrolase_10, Members of the Nudix 0.003
cd04666122 cd04666, Nudix_Hydrolase_9, Members of the Nudix h 0.003
>gnl|CDD|240027 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
 Score =  115 bits (289), Expect = 6e-33
 Identities = 51/95 (53%), Positives = 56/95 (58%), Gaps = 8/95 (8%)

Query: 107 HRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSID 166
           H VGVG  V+N K EVLVVQE   R +    WK P G+VD GEDI   AVREV EET ID
Sbjct: 1   HTVGVGGLVLNEKNEVLVVQE---RNKTPNGWKLPGGLVDPGEDIFDGAVREVLEETGID 57

Query: 167 TEFVEVLAFRY---VIFLKRIFYV--ESKPLLFII 196
           TEFV V+ FR+     F K   Y     KPL F I
Sbjct: 58  TEFVSVVGFRHAHPGAFGKSDLYFICRLKPLSFDI 92


Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. Length = 127

>gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information
>gnl|CDD|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|234820 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>gnl|CDD|240032 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240034 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240028 cd04671, Nudix_Hydrolase_13, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|223979 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|240030 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|240036 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240029 cd04672, Nudix_Hydrolase_14, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240055 cd04700, DR1025_like, DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>gnl|CDD|240035 cd04679, Nudix_Hydrolase_20, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239517 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>gnl|CDD|240033 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239644 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>gnl|CDD|240037 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240046 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240054 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>gnl|CDD|240040 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>gnl|CDD|239647 cd03675, Nudix_Hydrolase_2, Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>gnl|CDD|240023 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|215184 PLN02325, PLN02325, nudix hydrolase Back     alignment and domain information
>gnl|CDD|239519 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|240031 cd04674, Nudix_Hydrolase_16, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240052 cd04696, Nudix_Hydrolase_37, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|236516 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|240039 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|236361 PRK08999, PRK08999, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|239646 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240026 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240022 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240042 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|235436 PRK05379, PRK05379, bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|240044 cd04688, Nudix_Hydrolase_29, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|182721 PRK10776, PRK10776, nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|131752 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD Back     alignment and domain information
>gnl|CDD|240025 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240024 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
KOG0648295 consensus Predicted NUDIX hydrolase FGF-2 and rela 99.97
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.81
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.79
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.76
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 99.76
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.76
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.75
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.74
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 99.74
PLN02325144 nudix hydrolase 99.74
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.73
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.72
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 99.72
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.72
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 99.71
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.71
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.71
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 99.7
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.7
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 99.7
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.7
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.7
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.7
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 99.69
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.69
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 99.69
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.69
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.69
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 99.69
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 99.69
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.69
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 99.69
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 99.69
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.68
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 99.68
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 99.68
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 99.67
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 99.66
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 99.66
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.66
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.65
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.65
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 99.64
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.64
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.63
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 99.63
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 99.63
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 99.63
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 99.63
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.62
PRK00241256 nudC NADH pyrophosphatase; Reviewed 99.61
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.61
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.61
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 99.6
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 99.6
PRK10707190 putative NUDIX hydrolase; Provisional 99.6
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 99.59
PRK00714156 RNA pyrophosphohydrolase; Reviewed 99.59
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.59
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.59
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.59
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 99.57
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 99.56
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 99.56
PLN03143291 nudix hydrolase; Provisional 99.55
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 99.55
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 99.54
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 99.53
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 99.52
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 99.52
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 99.5
PRK08999 312 hypothetical protein; Provisional 99.49
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 99.49
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 99.48
PLN02709222 nudix hydrolase 99.48
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 99.48
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 99.46
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 99.41
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 99.34
KOG3084345 consensus NADH pyrophosphatase I of the Nudix fami 99.17
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 99.15
PLN02552247 isopentenyl-diphosphate delta-isomerase 99.14
KOG2839145 consensus Diadenosine and diphosphoinositol polyph 99.11
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 99.1
KOG3041225 consensus Nucleoside diphosphate-sugar hydrolase o 99.04
PLN02791 770 Nudix hydrolase homolog 99.0
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 98.98
KOG3069246 consensus Peroxisomal NUDIX hydrolase [Replication 98.83
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 98.59
PLN02839372 nudix hydrolase 98.26
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 97.93
KOG4195275 consensus Transient receptor potential-related cha 97.59
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 97.58
PRK10880350 adenine DNA glycosylase; Provisional 96.56
KOG2937 348 consensus Decapping enzyme complex, predicted pyro 96.31
KOG4432 405 consensus Uncharacterized NUDIX family hydrolase [ 96.26
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 95.93
KOG1689221 consensus mRNA cleavage factor I subunit [RNA proc 94.85
KOG0142225 consensus Isopentenyl pyrophosphate:dimethylallyl 92.65
COG4112203 Predicted phosphoesterase (MutT family) [General f 92.34
TIGR01084275 mutY A/G-specific adenine glycosylase. This equiva 91.93
KOG4432405 consensus Uncharacterized NUDIX family hydrolase [ 91.0
COG1194342 MutY A/G-specific DNA glycosylase [DNA replication 88.19
PRK13910289 DNA glycosylase MutY; Provisional 80.68
KOG4548263 consensus Mitochondrial ribosomal protein L17 [Tra 80.56
>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.97  E-value=2.5e-31  Score=227.77  Aligned_cols=166  Identities=61%  Similarity=0.978  Sum_probs=158.5

Q ss_pred             ceeccccCCCcEEEec-CCCCChHHHHHHHHHHHHHHHHcCcceEEEEcccccccchHHHHhcCceeeccCCceEEEEEe
Q 027279           15 FLNGINDNYGGVVVQM-NEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYW   93 (225)
Q Consensus        15 ~~~~~~d~~~gv~i~~-~~~~~~~~f~~~l~~~~~~w~~~~~~~iw~~~~~~~~~~~~~~~~~gf~~h~~~~~~~~l~~~   93 (225)
                      .+.+..|+|+||.++. ..+.|...|.+.++.|+++|+.+|++++|+++|...+++++.+.++||.|||+...|+|+..|
T Consensus        21 ~l~~~~D~~ggv~v~~~~~~~d~~~f~~~l~~Sl~~W~~~Gr~~iwl~l~~~~~~lV~~a~~~gf~~hHae~~~~~l~~W  100 (295)
T KOG0648|consen   21 LLAGLSDRYGGVVVDIVPEPMDEKLFIEELRASLQKWYLQGRKGIWLKLPEELARLVEEAAKYGFDYHHAESLYVMLTSW  100 (295)
T ss_pred             hhcccccccCCEEeecccCCCCHHHHHHHHHHHHHHHHHccCcccceechHHHHhHHHHHHhcCcEEecccccceeeeee
Confidence            5689999999999999 689999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCCCCCCCCCCcceeEEEEEEEeCCceEEEEEeecCCCCCCCcEEEeeEEcCCCCCHHHHHHHHHHHHhCCcccceeEE
Q 027279           94 IPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVL  173 (225)
Q Consensus        94 l~~~~~~~p~~~~~~~~v~~~v~~~~~~vLl~~r~~~~~~~~~~w~lPgG~ve~gE~~~~aa~REl~EEtGl~~~~~~~l  173 (225)
                      +++.+.++|.++.++++++++|+|.+++||+++...+.....|.|.+|+|.|++||++.++|+||++||||++..+..++
T Consensus       101 l~e~~~~lP~~Ash~vgvg~~V~n~~~eVlVv~e~d~~~~~~~~wK~ptG~v~~~e~i~~gavrEvkeetgid~ef~eVl  180 (295)
T KOG0648|consen  101 LREAPSTLPANASHRVGVGAFVLNKKKEVLVVQEKDGAVKIRGGWKLPTGRVEEGEDIWHGAVREVKEETGIDTEFVEVL  180 (295)
T ss_pred             eccccccCCCchhhheeeeeeEecCCceeEEEEecccceeecccccccceEecccccchhhhhhhhHHHhCcchhhhhHH
Confidence            99999999999999999999999998999999987777777899999999999999999999999999999999999999


Q ss_pred             EEEEEEe
Q 027279          174 AFRYVIF  180 (225)
Q Consensus       174 ~~~~~~~  180 (225)
                      ..++.|-
T Consensus       181 a~r~~H~  187 (295)
T KOG0648|consen  181 AFRRAHN  187 (295)
T ss_pred             HHHhhhc
Confidence            8887664



>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] Back     alignment and domain information
>KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] Back     alignment and domain information
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information
>KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] Back     alignment and domain information
>KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] Back     alignment and domain information
>TIGR01084 mutY A/G-specific adenine glycosylase Back     alignment and domain information
>KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] Back     alignment and domain information
>COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13910 DNA glycosylase MutY; Provisional Back     alignment and domain information
>KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3fxt_A113 Crystal Structure Of The N-Terminal Domain Of Human 5e-10
3h95_A199 Crystal Structure Of The Nudix Domain Of Nudt6 Leng 2e-09
1vc8_A126 Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydr 6e-06
1sjy_A159 Crystal Structure Of Nudix Hydrolase Dr1025 From De 6e-06
1vc9_A126 Crystal Structure Of A T.thermophilus Hb8 Ap6a Hydr 1e-05
1f3y_A165 Solution Structure Of The Nudix Enzyme Diadenosine 4e-05
3hhj_A158 Crystal Structure Of Mutator Mutt From Bartonella H 2e-04
3gg6_A156 Crystal Structure Of The Nudix Domain Of Human Nudt 7e-04
>pdb|3FXT|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Nudt6 Length = 113 Back     alignment and structure

Iteration: 1

Score = 61.2 bits (147), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 5/87 (5%) Query: 16 LNGINDNYGGVVVQMN-----EPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLV 70 L G D +GG+ V++ + +D F L++++ WR + + VW+ +PI + + Sbjct: 25 LQGELDRFGGISVRLARLDALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFI 84 Query: 71 EPAVKEGFWFHHAEPNYLMLVYWIPGG 97 PA GF FHHAE + L W+ G Sbjct: 85 APAASLGFCFHHAESDSSTLTLWLREG 111
>pdb|3H95|A Chain A, Crystal Structure Of The Nudix Domain Of Nudt6 Length = 199 Back     alignment and structure
>pdb|1VC8|A Chain A, Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydrolase Ndx1-Ap6a Complex Length = 126 Back     alignment and structure
>pdb|1SJY|A Chain A, Crystal Structure Of Nudix Hydrolase Dr1025 From Deinococcus Radiodurans Length = 159 Back     alignment and structure
>pdb|1VC9|A Chain A, Crystal Structure Of A T.thermophilus Hb8 Ap6a Hydrolase E50q Mutant- Mg2+-atp Complex Length = 126 Back     alignment and structure
>pdb|1F3Y|A Chain A, Solution Structure Of The Nudix Enzyme Diadenosine Tetraphosphate Hydrolase From Lupinus Angustifolius L. Length = 165 Back     alignment and structure
>pdb|3HHJ|A Chain A, Crystal Structure Of Mutator Mutt From Bartonella Henselae Length = 158 Back     alignment and structure
>pdb|3GG6|A Chain A, Crystal Structure Of The Nudix Domain Of Human Nudt18 Length = 156 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3fxt_A113 Nucleoside diphosphate-linked moiety X motif 6; nu 8e-36
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 7e-30
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 4e-18
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 7e-17
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 7e-17
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 3e-16
1xsa_A153 BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, 4e-15
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 1e-14
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 7e-14
3grn_A153 MUTT related protein; structural genomics, hydrola 7e-14
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 8e-14
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 8e-14
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 4e-13
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 6e-13
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 7e-13
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 8e-12
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 1e-11
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 1e-11
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 1e-11
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 2e-11
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 2e-11
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 9e-11
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 1e-10
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 1e-10
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 2e-10
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 2e-10
3f13_A163 Putative nudix hydrolase family member; structural 5e-10
3son_A149 Hypothetical nudix hydrolase; structural genomics, 8e-10
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 9e-10
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 2e-09
3exq_A161 Nudix family hydrolase; protein structure initiati 3e-09
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 3e-09
3fcm_A197 Hydrolase, nudix family; protein structure initiat 4e-09
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 2e-08
3f6a_A159 Hydrolase, nudix family; protein structure initiat 2e-08
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 3e-08
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 4e-08
2b06_A155 MUTT/nudix family protein; structural genomics, P 9e-08
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 1e-07
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 1e-07
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 1e-07
2fml_A 273 MUTT/nudix family protein; structural genomics, PS 2e-07
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 2e-07
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 2e-07
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 3e-07
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 3e-07
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 3e-07
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 4e-07
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 8e-07
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 3e-06
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 3e-06
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 5e-06
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 1e-05
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 2e-05
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 3e-05
2fb1_A226 Conserved hypothetical protein; structural genomic 3e-05
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 4e-05
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 5e-05
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 5e-05
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 3e-04
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 3e-04
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 3e-04
>3fxt_A Nucleoside diphosphate-linked moiety X motif 6; nudix, NUDT6, GFG, FGF2AS, antisense basic fibroblast growth FGF-2 regulation, hydrolase; 2.30A {Homo sapiens} Length = 113 Back     alignment and structure
 Score =  121 bits (305), Expect = 8e-36
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 5/96 (5%)

Query: 7   SSSATVNKFLNGINDNYGGVVVQMN-----EPMDPQLFASLLKSSISHWRQQAKKGVWIK 61
            +    +  L G  D +GG+ V++      + +D   F   L++++  WR + +  VW+ 
Sbjct: 16  ENLYFQSMDLQGELDRFGGISVRLARLDALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLH 75

Query: 62  LPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGG 97
           +PI  +  + PA   GF FHHAE +   L  W+  G
Sbjct: 76  IPILQSRFIAPAASLGFCFHHAESDSSTLTLWLREG 111


>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 Back     alignment and structure
>1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164 Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165 Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205 Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154 Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163 Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Length = 206 Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150 Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161 Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176 Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197 Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Length = 187 Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Length = 159 Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Length = 158 Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Length = 155 Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Length = 153 Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Length = 341 Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Length = 273 Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Length = 139 Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} Length = 144 Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188 Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Length = 140 Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Length = 189 Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} Length = 140 Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Length = 292 Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Length = 226 Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194 Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Length = 240 Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Length = 207 Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Length = 212 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
3fxt_A113 Nucleoside diphosphate-linked moiety X motif 6; nu 99.91
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.81
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.8
3grn_A153 MUTT related protein; structural genomics, hydrola 99.78
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 99.75
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.75
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 99.75
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.75
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.75
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.74
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.74
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.74
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.74
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 99.73
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.73
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.73
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.73
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.73
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.73
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.72
3exq_A161 Nudix family hydrolase; protein structure initiati 99.72
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.72
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.72
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.72
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.71
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.71
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.71
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 99.71
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.71
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.7
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.7
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.69
2fb1_A 226 Conserved hypothetical protein; structural genomic 99.69
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 99.69
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.69
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.68
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 99.68
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 99.68
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 99.67
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 99.67
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 99.67
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.66
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 99.66
2b06_A155 MUTT/nudix family protein; structural genomics, P 99.66
3f13_A163 Putative nudix hydrolase family member; structural 99.66
3fcm_A197 Hydrolase, nudix family; protein structure initiat 99.65
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 99.65
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 99.65
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 99.65
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.63
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 99.63
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 99.62
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 99.61
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 99.61
3gz5_A 240 MUTT/nudix family protein; DNA binding protein, nu 99.61
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.6
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 99.6
2fml_A 273 MUTT/nudix family protein; structural genomics, PS 99.6
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.6
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.59
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 99.58
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.58
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 99.55
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 99.55
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 99.55
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 99.54
3e57_A211 Uncharacterized protein TM1382; structural genomic 99.53
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 99.5
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 99.47
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 99.42
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 99.39
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 99.38
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 99.38
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 99.31
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 99.23
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 99.23
3bho_A208 Cleavage and polyadenylation specificity factor su 99.08
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 98.87
>3fxt_A Nucleoside diphosphate-linked moiety X motif 6; nudix, NUDT6, GFG, FGF2AS, antisense basic fibroblast growth FGF-2 regulation, hydrolase; 2.30A {Homo sapiens} Back     alignment and structure
Probab=99.91  E-value=7.7e-25  Score=163.24  Aligned_cols=87  Identities=31%  Similarity=0.712  Sum_probs=80.1

Q ss_pred             ccceeccccCCCcEEEec-----CCCCChHHHHHHHHHHHHHHHHcCcceEEEEcccccccchHHHHhcCceeeccCCce
Q 027279           13 NKFLNGINDNYGGVVVQM-----NEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNY   87 (225)
Q Consensus        13 ~~~~~~~~d~~~gv~i~~-----~~~~~~~~f~~~l~~~~~~w~~~~~~~iw~~~~~~~~~~~~~~~~~gf~~h~~~~~~   87 (225)
                      ..+|+|..|+||||+|+.     ..+.|.+.|.+.|+.||+.|+++|+++|||++|+.++++++.+++.||.||||+++|
T Consensus        22 ~~~l~g~~DrygGV~Vd~~~l~~~~~~d~~~F~~~L~~SL~~Wr~~gk~~IWlklpi~~s~lIp~a~~~GF~fHHAe~dy  101 (113)
T 3fxt_A           22 SMDLQGELDRFGGISVRLARLDALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDS  101 (113)
T ss_dssp             CCCCCCEECTTSCEEEEHHHHTTTSCBCHHHHHHHHHHHHHHHHHTTCCEEEEEEEGGGGGGHHHHHHTTCEEEEEEBTE
T ss_pred             cccccCCccCcCCEEEeCCccCCcCcCCHHHHHHHHHHHHHHHHHcCCeeEEEEcCHHHhhhHHHHHHcCceeecCCCCe
Confidence            468899999999999997     246799999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEeeCCCCC
Q 027279           88 LMLVYWIPGGAN   99 (225)
Q Consensus        88 ~~l~~~l~~~~~   99 (225)
                      +||++||+++++
T Consensus       102 lmL~~WLpe~ps  113 (113)
T 3fxt_A          102 STLTLWLREGPS  113 (113)
T ss_dssp             EEEEEECCC---
T ss_pred             EEEEEecCcCCC
Confidence            999999998763



>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d1vcda1126 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t 1e-12
d1sjya_158 d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc 4e-11
d2azwa1147 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E 5e-11
d1irya_156 d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha 7e-11
d1jkna_165 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 1e-09
d2a6ta2151 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c 2e-09
d2fvva1135 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat 9e-09
d1xsba_153 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 1e-08
d2b0va1146 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {N 1e-08
d1ryaa_160 d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD 2e-08
d1q33a_292 d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr 1e-07
d1k2ea_152 d.113.1.1 (A:) Hypothetical protein PAE3301 {Archa 3e-07
d2fmla2202 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N 2e-06
d1u20a1196 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 4e-06
d1hzta_153 d.113.1.2 (A:) Isopentenyl diphosphate isomerase { 9e-06
d1nqza_187 d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinoco 1e-05
d2b06a1155 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (s 2e-05
d2fb1a2147 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N 7e-05
d1vk6a2131 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escher 2e-04
d1vhza_186 d.113.1.1 (A:) ADP compounds hydrolase NudE {Esche 0.002
d1v8ya_158 d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus 0.003
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: AP6A hydrolase Ndx1
species: Thermus thermophilus [TaxId: 274]
 Score = 60.4 bits (146), Expect = 1e-12
 Identities = 28/80 (35%), Positives = 39/80 (48%), Gaps = 6/80 (7%)

Query: 108 RVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDT 167
            +G G  V N KREVL++++  G       W FP G  + GE +  AAVREV EET +  
Sbjct: 2   ELGAGGVVFNAKREVLLLRDRMGF------WVFPKGHPEPGESLEEAAVREVWEETGVRA 55

Query: 168 EFVEVLAFRYVIFLKRIFYV 187
           E +  L     +  K +   
Sbjct: 56  EVLLPLYPTRYVNPKGVERE 75


>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165 Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Length = 146 Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 152 Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Length = 202 Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 196 Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Length = 153 Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Length = 187 Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Length = 155 Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 147 Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 131 Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Length = 186 Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.78
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.78
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.77
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.76
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.74
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.74
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.74
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 99.73
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.72
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.71
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.71
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.69
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.69
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.66
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.66
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.66
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 99.66
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.65
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.63
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 99.62
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.62
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.62
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 99.61
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.59
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 99.58
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 99.49
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 99.31
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 99.27
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 99.21
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 99.17
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: AP6A hydrolase Ndx1
species: Thermus thermophilus [TaxId: 274]
Probab=99.78  E-value=1.4e-18  Score=130.68  Aligned_cols=98  Identities=32%  Similarity=0.427  Sum_probs=71.4

Q ss_pred             eeEEEEEEEeCCceEEEEEeecCCCCCCCcEEEeeEEcCCCCCHHHHHHHHHHHHhCCcccceeEEEEEEEEeeeeeeee
Q 027279          108 RVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRYVIFLKRIFYV  187 (225)
Q Consensus       108 ~~~v~~~v~~~~~~vLl~~r~~~~~~~~~~w~lPgG~ve~gE~~~~aa~REl~EEtGl~~~~~~~l~~~~~~~~~~~~~~  187 (225)
                      .++|+++|++.++++|+++++      .|.|.+|||++++|||+.+||+||++||||+++.....++...+...      
T Consensus         2 ~v~agavv~~~~~~vLl~~~~------~g~w~~PgG~ve~gEt~~~aa~RE~~EEtGi~~~~~~~~~~~~~~~~------   69 (126)
T d1vcda1           2 ELGAGGVVFNAKREVLLLRDR------MGFWVFPKGHPEPGESLEEAAVREVWEETGVRAEVLLPLYPTRYVNP------   69 (126)
T ss_dssp             EEEEEEEEECTTSCEEEEECT------TSCEECCEECCCTTCCHHHHHHHHHHHHHCCEEEEEEEEEEEEEECT------
T ss_pred             EEEEEEEEEECCCEEEEEEcC------CCCEECCccccCCCCCHHHHHHHHHHHHcCCeeEEEEEEeeeeeccC------
Confidence            478999999999999999875      37899999999999999999999999999999887776665443221      


Q ss_pred             CCccEEEEEEEEEeeCCeeeecCCceeeeEE
Q 027279          188 ESKPLLFIIFQFEVYTSLPVCHCGQAMMQRF  218 (225)
Q Consensus       188 ~~~~~~~~~f~~~~~~g~~~~~e~~e~~~~f  218 (225)
                      ...+...++|.+.. .+.+...++.....||
T Consensus        70 ~~~~~~~~~~~~~~-~~~~~~~~e~~~~~W~   99 (126)
T d1vcda1          70 KGVEREVHWFLMRG-EGAPRLEEGMTGAGWF   99 (126)
T ss_dssp             TSCEEEEEEEEEEE-ESCCCCCTTCCEEEEE
T ss_pred             CCeEEEEEEEEEEE-cCCCCCCccceEEEEE
Confidence            12233445566554 4555555444334444



>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure