Query         027308
Match_columns 225
No_of_seqs    51 out of 53
Neff          2.8 
Searched_HMMs 46136
Date          Fri Mar 29 08:00:34 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/027308.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/027308hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08536 Whirly:  Whirly transc 100.0 5.9E-63 1.3E-67  405.8  14.3  132   90-221     1-138 (139)
  2 PF02035 Coagulin:  Coagulin;    68.2     4.8  0.0001   34.8   2.7   51   85-142    75-125 (174)
  3 PRK12301 bssS biofilm formatio  61.7     2.4 5.3E-05   33.4  -0.2   16    1-16     27-42  (84)
  4 PF08624 CRC_subunit:  Chromati  30.0      32 0.00069   29.2   1.6   49  110-168    14-69  (139)
  5 PF13991 BssS:  BssS protein fa  29.0      26 0.00056   26.9   0.8   16    1-16     17-32  (73)
  6 cd01680 EFG_like_IV Elongation  23.1 2.3E+02   0.005   21.2   5.0   31  163-194    11-41  (116)
  7 PRK04179 rpl37e 50S ribosomal   19.2      32 0.00069   25.9  -0.4   14  129-142    42-55  (62)
  8 PF01907 Ribosomal_L37e:  Ribos  17.8      57  0.0012   24.0   0.7   13  129-141    39-52  (55)
  9 KOG1528 Salt-sensitive 3'-phos  17.0      23  0.0005   34.1  -1.9   56  162-225   229-292 (351)
 10 PF11807 DUF3328:  Domain of un  15.9      44 0.00096   26.6  -0.3   10    1-10    127-136 (217)

No 1  
>PF08536 Whirly:  Whirly transcription factor;  InterPro: IPR013742 This is a family of plant transcription factors. ; PDB: 3R9Y_A 3N1I_A 3N1K_A 3RA0_A 3N1H_A 3N1J_A 3N1L_A 3R9Z_A 1L3A_D.
Probab=100.00  E-value=5.9e-63  Score=405.80  Aligned_cols=132  Identities=64%  Similarity=0.999  Sum_probs=113.0

Q ss_pred             eeeeCceeEEEeecCCceeecCCcceEEeeeceEEEEeeccccCccccCCcceEEEEehhhhhhhhhccCccceeEeecC
Q 027308           90 SIYKGKAALTVEPRGPEFVSLDSGAVKLSREGFVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSLVALGARESCEFFHDP  169 (225)
Q Consensus        90 sIYKgKAAlsv~p~~P~F~~l~SG~~kv~R~G~vlLeFAPA~G~RqYDW~kKq~FsLS~tEvG~LlsLga~~sceFFHDP  169 (225)
                      +||||||||+|+|++|+|++++||+++++|+|+||||||||+|+|||||+|||+|||||+|+|+||+|+++++|||||||
T Consensus         1 sVYk~kaAl~v~p~~P~f~~~~sg~~kv~R~G~vlLefapa~g~r~YDW~kKq~FsLS~tEvG~ll~l~~~~s~effHdP   80 (139)
T PF08536_consen    1 SVYKGKAALSVRPIKPTFTSLDSGYFKVSREGSVLLEFAPAVGPRQYDWSKKQTFSLSPTEVGSLLSLGARESCEFFHDP   80 (139)
T ss_dssp             EEEESSEEEEEEEE--EEEE-TTSCEEEEC--EEEEEEEEBCSTTEB-GGG-EEEEE-HHHHHHHHT--TT--EEEEE-T
T ss_pred             CccccceeEEEEecCCccEECCCCcEEEeeccEEEEEEccccCCcccccccceEEEEcHHHhhhhhhhccCCceEEEecc
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCceeEEEEEEECCCCCcceEEEEeccccce------eeeccccchhhhhhh
Q 027308          170 FKGKSEEGKVRKVLKVEPLPDGSGHFFNLSNALFLEL------LAVNLEDYLLFDDKI  221 (225)
Q Consensus       170 ~mg~S~eGkvrK~LkVeP~pDGsG~ffnLsV~n~~~~------~~ln~~e~~vf~~~~  221 (225)
                      +||+|++|+|||+|||||||||+||||||+|+|+++|      |-|...||+|+|.+.
T Consensus        81 ~~~~s~~G~v~K~Lkv~p~~dgsg~f~~Lsv~~~~~~~~~~~~ipVt~aEfavl~s~f  138 (139)
T PF08536_consen   81 NMGSSNEGKVRKSLKVEPLPDGSGYFFNLSVQNKLLNGDENFSIPVTKAEFAVLRSAF  138 (139)
T ss_dssp             TTTSTTTTSEEEEEEEEE-TTSSEEEEEEEEEECCCTEEEEEEEEEEHHHHHHHHHHH
T ss_pred             ccCCCCCCceEEEEEeEECCCCCceEEEEEEecccccccceEEEechHHHHHHHHHhh
Confidence            9999999999999999999999999999999999776      557778999998753


No 2  
>PF02035 Coagulin:  Coagulin;  InterPro: IPR000275 Coagulogen is a gel-forming protein of hemolymph that hinders the spread of invaders by immobilising them [, ]. The protein contains a single 175- residue polypeptide chain; this is cleaved after Arg-18 and Arg-46 by a clotting enzyme contained in the hemocyte and activated by a bacterial endotoxin (lipopolysaccharide). Cleavage releases two chains of coagulin, A and B, linked by two disulphide bonds, together with the peptide C [, ]. Gel formation results from interlinking of coagulin molecules. Secondary structure prediction suggests the C peptide forms an alpha- helix, which is released during the proteolytic conversion of coagulogen to coagulin gel []. The beta-sheet structure and 16 half-cystines found in the molecule appear to yield a compact protein stable to acid and heat. Mammalian blood coagulation is based on the proteolytically induced polymerisation of fibrinogens. Initially, fibrin monomers noncovalently interact with each other. The resulting homopolymers are further stabilised when the plasma transglutaminase (TGase) intermolecularly cross-links epsilon-(gamma-glutamyl)lysine bonds. In crustaceans, hemolymph coagulation depends on the TGase-mediated cross-linking of specific plasma-clotting proteins, but without the proteolytic cascade. In horseshoe crabs, the proteolytic coagulation cascade triggered by lipopolysaccharides and beta-1,3-glucans leads to the conversion of coagulogen into coagulin, resulting in noncovalent coagulin homopolymers through head-to-tail interaction. Horseshoe crab TGase, however, does not cross-link coagulins intermolecularly. Recently, we found that coagulins are cross-linked on hemocyte cell surface proteins called proxins. This indicates that a cross-linking reaction at the final stage of hemolymph coagulation is an important innate immune system of horseshoe crabs [].; GO: 0042381 hemolymph coagulation, 0005576 extracellular region; PDB: 1AOC_A.
Probab=68.16  E-value=4.8  Score=34.85  Aligned_cols=51  Identities=24%  Similarity=0.393  Sum_probs=27.3

Q ss_pred             eeeeeeeeeCceeEEEeecCCceeecCCcceEEeeeceEEEEeeccccCccccCCcce
Q 027308           85 VYVGHSIYKGKAALTVEPRGPEFVSLDSGAVKLSREGFVMLQFAPAAGVRQYDWSRKQ  142 (225)
Q Consensus        85 Vy~~ysIYKgKAAlsv~p~~P~F~~l~SG~~kv~R~G~vlLeFAPA~G~RqYDW~kKq  142 (225)
                      -|++|.-|+...-.+.+..-|.|.-.-+|.+++      + -=||.+|-||--|+.|-
T Consensus        75 nf~pf~hf~secpvstrdcepvfgyt~a~efrv------i-vqapragfrqcvwqhkc  125 (174)
T PF02035_consen   75 NFPPFHHFKSECPVSTRDCEPVFGYTVAGEFRV------I-VQAPRAGFRQCVWQHKC  125 (174)
T ss_dssp             GSTT----SSB--EEEE----SEEE-TTS-EEE------E---BCCCTB-B---EEEE
T ss_pred             cCCCcccccccCCcccccccccccceecceEEE------E-EeCchhhHHHHHHHhhh
Confidence            366788999999999999999999988886643      3 34899999999999884


No 3  
>PRK12301 bssS biofilm formation regulatory protein BssS; Reviewed
Probab=61.66  E-value=2.4  Score=33.42  Aligned_cols=16  Identities=31%  Similarity=0.565  Sum_probs=14.0

Q ss_pred             CceeeeecccCCCCCC
Q 027308            1 MMLQLQCLSSQTLNPK   16 (225)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (225)
                      ||++||.|||+.|.+.
T Consensus        27 mmirlhyLss~~Q~~e   42 (84)
T PRK12301         27 LMLRLHYQSPNDQEPE   42 (84)
T ss_pred             HHHhhhhcCCCCCCcc
Confidence            7999999999987664


No 4  
>PF08624 CRC_subunit:  Chromatin remodelling complex Rsc7/Swp82 subunit;  InterPro: IPR013933  This entry contains subunits of the chromatin remodelling complexes. Saccharomyces cerevisiae (Baker's yeast) P32832 from SWISSPROT and its paralogue P43554 from SWISSPROT have been identified as subunits of the RSC chromatin remodelling complex, and SWI/SNF chromatin remodelling complex respectively []. 
Probab=30.01  E-value=32  Score=29.20  Aligned_cols=49  Identities=29%  Similarity=0.551  Sum_probs=35.5

Q ss_pred             cCCcceEEeeeceEEEEeeccccCccccC-------CcceEEEEehhhhhhhhhccCccceeEeec
Q 027308          110 LDSGAVKLSREGFVMLQFAPAAGVRQYDW-------SRKQVFSLSVTEIGSLVALGARESCEFFHD  168 (225)
Q Consensus       110 l~SG~~kv~R~G~vlLeFAPA~G~RqYDW-------~kKq~FsLS~tEvG~LlsLga~~sceFFHD  168 (225)
                      .+.|--||++.|-++       |.|+|--       .....|+|| +|+.-++  |-++|.+|||.
T Consensus        14 Dp~GE~KId~~G~Ll-------gGR~y~~~TFtl~~rg~~lymL~-td~ar~l--g~rDs~~ff~~   69 (139)
T PF08624_consen   14 DPKGEKKIDKNGRLL-------GGREYRFRTFTLPGRGNRLYMLS-TDPARCL--GFRDSYLFFRK   69 (139)
T ss_pred             CCCcCeEeCCCCccc-------CCCEEEEEEEEeCCCCCeEEEEe-HHHHHHh--ccccHHHHHHh
Confidence            356778999999885       6676633       125678886 5666555  99999999984


No 5  
>PF13991 BssS:  BssS protein family
Probab=29.03  E-value=26  Score=26.93  Aligned_cols=16  Identities=44%  Similarity=0.663  Sum_probs=13.4

Q ss_pred             CceeeeecccCCCCCC
Q 027308            1 MMLQLQCLSSQTLNPK   16 (225)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (225)
                      ||++||.||++.|.+.
T Consensus        17 l~lrl~yls~~~q~~e   32 (73)
T PF13991_consen   17 LMLRLHYLSSPDQPPE   32 (73)
T ss_pred             eEEEecccCCCCCCcc
Confidence            7999999999977654


No 6  
>cd01680 EFG_like_IV Elongation Factor G-like domain IV. This family includes the translational elongation factor termed EF-2 (for Archaea and Eukarya) and EF-G (for Bacteria), ribosomal protection proteins that mediate tetracycline resistance and, an evolutionarily conserved U5 snRNP-specific protein (U5-116kD). In complex with GTP, EF-G/EF-2  promotes the translocation step of translation. During translocation the peptidyl-tRNA is moved from the A site to the P site of the small subunit of ribosome and the mRNA is shifted one codon relative to the ribosome. It has been shown that EF-G/EF-2_IV domain mimics the shape of anticodon arm of the tRNA in the structurally homologous ternary complex of Petra, EF-Tu (another transcriptional elongation factor) and GTP analog. The tip portion of this domain is found in a position that overlaps the anticodon arm of the A-site tRNA, implying that EF-G/EF-2 displaces the A-site tRNA to the P-site by physical interaction with the anticodon arm.
Probab=23.14  E-value=2.3e+02  Score=21.17  Aligned_cols=31  Identities=29%  Similarity=0.229  Sum_probs=20.8

Q ss_pred             eeEeecCCCCCCCCCceeEEEEEEECCCCCcc
Q 027308          163 CEFFHDPFKGKSEEGKVRKVLKVEPLPDGSGH  194 (225)
Q Consensus       163 ceFFHDP~mg~S~eGkvrK~LkVeP~pDGsG~  194 (225)
                      ++..|+.-.|.. .+..+=+|.|||+++|+|.
T Consensus        11 ~~~~~~~~~gg~-~~~a~v~l~veP~~~~~~~   41 (116)
T cd01680          11 ATGEFERELGGK-PQFGEVTLRVEPLERGSGV   41 (116)
T ss_pred             eeEEEccccCCC-CeEEEEEEEEEECCCCCCc
Confidence            344555554433 3446779999999998876


No 7  
>PRK04179 rpl37e 50S ribosomal protein L37e; Reviewed
Probab=19.18  E-value=32  Score=25.91  Aligned_cols=14  Identities=29%  Similarity=0.852  Sum_probs=10.8

Q ss_pred             ccccCccccCCcce
Q 027308          129 PAAGVRQYDWSRKQ  142 (225)
Q Consensus       129 PA~G~RqYDW~kKq  142 (225)
                      |+.--|.|+|++|-
T Consensus        42 ps~k~R~YnWs~Ka   55 (62)
T PRK04179         42 RSKRIRRYSWQNKK   55 (62)
T ss_pred             cccccccccHHHHh
Confidence            55557999999874


No 8  
>PF01907 Ribosomal_L37e:  Ribosomal protein L37e;  InterPro: IPR001569 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of proteins of 56 to 96 amino-acid residues that share a highly conserved region located in the N-terminal part.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A19_A 4A1D_A 4A18_A 4A1B_A 1S1I_Y 3O5H_d 3IZS_l 3O58_d 2ZKR_2 3IZR_l ....
Probab=17.78  E-value=57  Score=24.01  Aligned_cols=13  Identities=62%  Similarity=1.147  Sum_probs=6.8

Q ss_pred             ccccCc-cccCCcc
Q 027308          129 PAAGVR-QYDWSRK  141 (225)
Q Consensus       129 PA~G~R-qYDW~kK  141 (225)
                      |+.--| +|+|+.|
T Consensus        39 p~~kkrr~ynWs~K   52 (55)
T PF01907_consen   39 PAAKKRRKYNWSAK   52 (55)
T ss_dssp             TTSSS----SSSSH
T ss_pred             Ccccccccccchhh
Confidence            444456 9999987


No 9  
>KOG1528 consensus Salt-sensitive 3'-phosphoadenosine-5'-phosphatase HAL2/SAL1 [Nucleotide transport and metabolism; Inorganic ion transport and metabolism]
Probab=16.97  E-value=23  Score=34.09  Aligned_cols=56  Identities=20%  Similarity=0.271  Sum_probs=35.0

Q ss_pred             ceeEeecCCCCCCCCCceeEEEEEEECCCCCcceEEEEeccccceeeeccccchh--------hhhhhhccC
Q 027308          162 SCEFFHDPFKGKSEEGKVRKVLKVEPLPDGSGHFFNLSNALFLELLAVNLEDYLL--------FDDKIYDHL  225 (225)
Q Consensus       162 sceFFHDP~mg~S~eGkvrK~LkVeP~pDGsG~ffnLsV~n~~~~~~ln~~e~~v--------f~~~~~~~~  225 (225)
                      =||=+|-|.-.......|.+.|+|+-.|--=        .....-+.|.-||+-|        |+|+|+||-
T Consensus       229 f~Es~e~~~s~h~~~~~IankLgI~~~P~~i--------~SqaKYaalarGdaeVyLrf~~k~y~EkIWDHA  292 (351)
T KOG1528|consen  229 FCESVEKGHSIHGFQSTIANKLGIKKLPTRI--------DSQAKYAALARGDAEVYLRFPLKGYREKIWDHA  292 (351)
T ss_pred             eecccccCCccchhhHHHHHhhCcccCCcee--------chhHHHHHHhcCCcceeEeecccccchhhhhcc
Confidence            5677777776555567888888887765321        1111114455555444        699999993


No 10 
>PF11807 DUF3328:  Domain of unknown function (DUF3328);  InterPro: IPR021765  This family of proteins are functionally uncharacterised. This family is only found in eukaryotes. 
Probab=15.86  E-value=44  Score=26.57  Aligned_cols=10  Identities=40%  Similarity=0.806  Sum_probs=7.5

Q ss_pred             Cceeeeeccc
Q 027308            1 MMLQLQCLSS   10 (225)
Q Consensus         1 ~~~~~~~~~~   10 (225)
                      |+||||||..
T Consensus       127 vfHqLHCL~~  136 (217)
T PF11807_consen  127 VFHQLHCLNM  136 (217)
T ss_pred             cchhhhhhHH
Confidence            5788999843


Done!