BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027321
         (225 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4DN1|A Chain A, Crystal Structure Of An Enolase (Mandelate Racemase
           Subgroup Member) From Agrobacterium Tumefaciens (Target
           Efi-502088) With Bound Mg And Formate
 pdb|4DN1|B Chain B, Crystal Structure Of An Enolase (Mandelate Racemase
           Subgroup Member) From Agrobacterium Tumefaciens (Target
           Efi-502088) With Bound Mg And Formate
          Length = 408

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%)

Query: 161 NLKVIATPNAKTLLDPLFQNNPVRALKLKVEMVP 194
           NL+ +  P AK   D  +   P RAL+L  EM P
Sbjct: 220 NLRQVLGPQAKIAADMHWNQTPERALELIAEMQP 253


>pdb|2NQL|A Chain A, Crystal Structure Of A Member Of The Enolase Superfamily
           From Agrobacterium Tumefaciens
 pdb|2NQL|B Chain B, Crystal Structure Of A Member Of The Enolase Superfamily
           From Agrobacterium Tumefaciens
          Length = 388

 Score = 28.9 bits (63), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%)

Query: 161 NLKVIATPNAKTLLDPLFQNNPVRALKLKVEMVP 194
           NL+ +  P AK   D  +   P RAL+L  EM P
Sbjct: 200 NLRQVLGPQAKIAADMHWNQTPERALELIAEMQP 233


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.137    0.422 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,167,905
Number of Sequences: 62578
Number of extensions: 229129
Number of successful extensions: 460
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 458
Number of HSP's gapped (non-prelim): 2
length of query: 225
length of database: 14,973,337
effective HSP length: 95
effective length of query: 130
effective length of database: 9,028,427
effective search space: 1173695510
effective search space used: 1173695510
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)