BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 027342
(224 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4APX|B Chain B, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And
Protocadherin-15 Ec1-2 Form I
pdb|4AQ8|C Chain C, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And
Protocadherin-15 Ec1-2 Form Ii
pdb|4AQ8|D Chain D, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And
Protocadherin-15 Ec1-2 Form Ii
pdb|4AQA|B Chain B, Crystal Structure Of Deafness Associated Mutant Mouse
Cadherin-23 Ec1-2d124g And Protocadherin-15 Ec1-2 Form
I
pdb|4AQE|B Chain B, Crystal Structure Of Deafness Associated Mutant Mouse
Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I
pdb|4AXW|B Chain B, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And
Protocadherin-15 Ec1-2, Form I 2.2a
Length = 242
Score = 28.5 bits (62), Expect = 2.9, Method: Compositional matrix adjust.
Identities = 11/24 (45%), Positives = 17/24 (70%)
Query: 21 DPLVDLSLIDSTELWLIQWPYKQM 44
DP ++LSL D+ + W++ P KQM
Sbjct: 50 DPTIELSLKDNVDYWVLLDPVKQM 73
>pdb|3DLD|A Chain A, Crystal Structure Of Peptide Deformylase, Xoo1075, From
Xanthomonas Oryzae Pv. Oryzae Kacc10331
Length = 171
Score = 27.3 bits (59), Expect = 6.3, Method: Compositional matrix adjust.
Identities = 11/34 (32%), Positives = 18/34 (52%)
Query: 167 RYKSFSPEGGEPSKHSKRRRAHEPNHSTDHSLGR 200
RY+ F+P+G + ++ A H DH +GR
Sbjct: 116 RYRGFAPDGSPIEREAEGFHARVVQHEYDHLVGR 149
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.310 0.128 0.370
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,196,242
Number of Sequences: 62578
Number of extensions: 301408
Number of successful extensions: 451
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 449
Number of HSP's gapped (non-prelim): 5
length of query: 224
length of database: 14,973,337
effective HSP length: 95
effective length of query: 129
effective length of database: 9,028,427
effective search space: 1164667083
effective search space used: 1164667083
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 49 (23.5 bits)