BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027342
         (224 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4APX|B Chain B, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And
          Protocadherin-15 Ec1-2 Form I
 pdb|4AQ8|C Chain C, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And
          Protocadherin-15 Ec1-2 Form Ii
 pdb|4AQ8|D Chain D, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And
          Protocadherin-15 Ec1-2 Form Ii
 pdb|4AQA|B Chain B, Crystal Structure Of Deafness Associated Mutant Mouse
          Cadherin-23 Ec1-2d124g And Protocadherin-15 Ec1-2 Form
          I
 pdb|4AQE|B Chain B, Crystal Structure Of Deafness Associated Mutant Mouse
          Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I
 pdb|4AXW|B Chain B, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And
          Protocadherin-15 Ec1-2, Form I 2.2a
          Length = 242

 Score = 28.5 bits (62), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 17/24 (70%)

Query: 21 DPLVDLSLIDSTELWLIQWPYKQM 44
          DP ++LSL D+ + W++  P KQM
Sbjct: 50 DPTIELSLKDNVDYWVLLDPVKQM 73


>pdb|3DLD|A Chain A, Crystal Structure Of Peptide Deformylase, Xoo1075, From
           Xanthomonas Oryzae Pv. Oryzae Kacc10331
          Length = 171

 Score = 27.3 bits (59), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 18/34 (52%)

Query: 167 RYKSFSPEGGEPSKHSKRRRAHEPNHSTDHSLGR 200
           RY+ F+P+G    + ++   A    H  DH +GR
Sbjct: 116 RYRGFAPDGSPIEREAEGFHARVVQHEYDHLVGR 149


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.128    0.370 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,196,242
Number of Sequences: 62578
Number of extensions: 301408
Number of successful extensions: 451
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 449
Number of HSP's gapped (non-prelim): 5
length of query: 224
length of database: 14,973,337
effective HSP length: 95
effective length of query: 129
effective length of database: 9,028,427
effective search space: 1164667083
effective search space used: 1164667083
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 49 (23.5 bits)