BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027350
         (224 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1CEN|A Chain A, Cellulase (Celc) Mutant With Glu 140 Replaced By Gln
           Complexed With Cellohexaose
 pdb|1CEO|A Chain A, Cellulase (Celc) Mutant With Glu 140 Replaced By Gln
          Length = 343

 Score = 28.5 bits (62), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 171 NDGQIGNFGFSSEFLASASK-FWTERASSIWQDVQYESQYESLE 213
           +D  + NF F + F  +  K  W+E A +  + V+Y  QYE +E
Sbjct: 190 DDYIVYNFHFYNPFFFTHQKAHWSESAMAYNRTVKYPGQYEGIE 233


>pdb|1CEC|A Chain A, A Common Protein Fold And Similar Active Site In Two
           Distinct Families Of Beta-Glycanases
          Length = 343

 Score = 28.5 bits (62), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 171 NDGQIGNFGFSSEFLASASK-FWTERASSIWQDVQYESQYESLE 213
           +D  + NF F + F  +  K  W+E A +  + V+Y  QYE +E
Sbjct: 190 DDYIVYNFHFYNPFFFTHQKAHWSESAMAYNRTVKYPGQYEGIE 233


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.129    0.366 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,473,446
Number of Sequences: 62578
Number of extensions: 128574
Number of successful extensions: 540
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 531
Number of HSP's gapped (non-prelim): 13
length of query: 224
length of database: 14,973,337
effective HSP length: 95
effective length of query: 129
effective length of database: 9,028,427
effective search space: 1164667083
effective search space used: 1164667083
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)