BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 027350
(224 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1CEN|A Chain A, Cellulase (Celc) Mutant With Glu 140 Replaced By Gln
Complexed With Cellohexaose
pdb|1CEO|A Chain A, Cellulase (Celc) Mutant With Glu 140 Replaced By Gln
Length = 343
Score = 28.5 bits (62), Expect = 2.9, Method: Compositional matrix adjust.
Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
Query: 171 NDGQIGNFGFSSEFLASASK-FWTERASSIWQDVQYESQYESLE 213
+D + NF F + F + K W+E A + + V+Y QYE +E
Sbjct: 190 DDYIVYNFHFYNPFFFTHQKAHWSESAMAYNRTVKYPGQYEGIE 233
>pdb|1CEC|A Chain A, A Common Protein Fold And Similar Active Site In Two
Distinct Families Of Beta-Glycanases
Length = 343
Score = 28.5 bits (62), Expect = 2.9, Method: Compositional matrix adjust.
Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
Query: 171 NDGQIGNFGFSSEFLASASK-FWTERASSIWQDVQYESQYESLE 213
+D + NF F + F + K W+E A + + V+Y QYE +E
Sbjct: 190 DDYIVYNFHFYNPFFFTHQKAHWSESAMAYNRTVKYPGQYEGIE 233
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.129 0.366
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,473,446
Number of Sequences: 62578
Number of extensions: 128574
Number of successful extensions: 540
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 531
Number of HSP's gapped (non-prelim): 13
length of query: 224
length of database: 14,973,337
effective HSP length: 95
effective length of query: 129
effective length of database: 9,028,427
effective search space: 1164667083
effective search space used: 1164667083
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)