Citrus Sinensis ID: 027358


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MATPPLKAVTLTHVRYRKGDQLGHFLAWVSLVPVFISLGGFVSHFIFRREIQGMFFALGLLVSQFINEFIKTTVQQARPEMCVLLETCDSHGWPSSHSQYMFFFAVYFTLLTCKGIGLWGIKNRWFSNVLHWTLAVLTMYSRVYLGYHTVAQVFSGAILGILIGAGWFWFVNSVLFPYFPAIEESAFGRYFYVKDTSHIPDPLKFEYDNARAARSSANKVSKSN
ccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccc
***PPLKAVTLTHVRYRKGDQLGHFLAWVSLVPVFISLGGFVSHFIFRREIQGMFFALGLLVSQFINEFIKTTVQQARPEMCVLLETCDSHGWPSSHSQYMFFFAVYFTLLTCKGIGLWGIKNRWFSNVLHWTLAVLTMYSRVYLGYHTVAQVFSGAILGILIGAGWFWFVNSVLFPYFPAIEESAFGRYFYVKDTSHIPDPLKFEYDN***************
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATPPLKAVTLTHVRYRKGDQLGHFLAWVSLVPVFISLGGFVSHFIFRREIQGMFFALGLLVSQFINEFIKTTVQQARPEMCVLLETCDSHGWPSSHSQYMFFFAVYFTLLTCKGIGLWGIKNRWFSNVLHWTLAVLTMYSRVYLGYHTVAQVFSGAILGILIGAGWFWFVNSVLFPYFPAIEESAFGRYFYVKDTSHIPDPLKFEYDNARAARSSANKVSKSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dolichyldiphosphatase 1 Required for efficient N-glycosylation. Necessary for maintaining optimal levels of dolichol-linked oligosaccharides. Hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. Does not act on phosphatidate.probableQ86IX2
Dolichyldiphosphatase 1 Required for efficient N-glycosylation. Necessary for maintaining optimal levels of dolichol-linked oligosaccharides. Hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. Does not act on phosphatidate.probableQ86YN1
Dolichyldiphosphatase 1 Required for efficient N-glycosylation. Necessary for maintaining optimal levels of dolichol-linked oligosaccharides. Hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. Does not act on phosphatidate.probableB0KWE9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.1.-In phosphorous-containing anhydrides.probable
3.6.1.43Dolichyldiphosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IPB, chain A
Confidence level:confident
Coverage over the Query: 65-168
View the alignment between query and template
View the model in PyMOL