Citrus Sinensis ID: 027364


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MAEDLVLDLEELRQLRSIAKRPRIVSLINSEIHTLEKLSKEEGPAPVPTPAKVSSTPALNYITLGSFSWDQDNEKVKIYISLEGVVQDKMEAEFKQWSFDVKFHDVQGKNYRFTSPRLNQEIVPEKSKVLVKPTRVVIMLFKASKGNWLDLQYKEDKLKPNLDKERDPMAGIMDLMKVSCLLFMLHPHVKNMYEEGDDEMKRTIAKAWTDARSGKTADPLKGYP
cHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccCEEECcccEEEEEEEEccccccccEEEEEEcEEEEEEEccccccEEEccccccccccccccEEEEEccEEEEEEEEcccccccccCCccccccccccccccccccccHHHHHHHccccccHHHHHHcccccHHHHHHHHHHHHHHccccccccccccc
**EDLVLDLEELRQLRSIAKRPRIVSLINSEI*************************ALNYITLGSFSWDQDNEKVKIYISLEGVVQDKMEAEFKQWSFDVKFHDVQGKNYRFTSPRLNQEIVPEKSKVLVKPTRVVIMLFKASKGNWLDLQYK**************MAGIMDLMKVSCLLFMLHPHVKNMY****DEMKRTI********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEDLVLDLEELRQLRSIAKRPRIVSLINSEIHTLEKLSKEEGPAPVPTPAKVSSTPALNYITLGSFSWDQDNEKVKIYISLEGVVQDKMEAEFKQWSFDVKFHDVQGKNYRFTSPRLNQEIVPEKSKVLVKPTRVVIMLFKASKGNWLDLQYKEDKLKPNLDKERDPMAGIMDLMKVSCLLFMLHPHVKNMYEEGDDEMKRTIAKAWTDARSGKTADPLKGYP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcyclin-binding protein May be involved in calcium-dependent ubiquitination and subsequent proteasomal degradation of target proteins. Probably serves as a molecular bridge in ubiquitin E3 complexes. Participates in the ubiquitin-mediated degradation of beta-catenin (CTNNB1).probableQ9HB71
Calcyclin-binding protein May be involved in calcium-dependent ubiquitination and subsequent proteasomal degradation of target proteins. Probably serves as a molecular bridge in ubiquitin E3 complexes. Participates in the ubiquitin-mediated degradation of beta-catenin (CTNNB1).probableQ9CXW3
Calcyclin-binding protein May be involved in calcium-dependent ubiquitination and subsequent proteasomal degradation of target proteins. Probably serves as a molecular bridge in ubiquitin E3 complexes. Participates in the ubiquitin-mediated degradation of beta-catenin (CTNNB1).probableQ5R6Z8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X5M, chain A
Confidence level:very confident
Coverage over the Query: 58-157
View the alignment between query and template
View the model in PyMOL
Template: 2JTT, chain C
Confidence level:confident
Coverage over the Query: 169-177,191-212
View the alignment between query and template
View the model in PyMOL
Template: 2A26, chain A
Confidence level:confident
Coverage over the Query: 1-41
View the alignment between query and template
View the model in PyMOL