Citrus Sinensis ID: 027374


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MKVPRSLQIWRLGIVNYSDALKLQEKLVSDRKIHKISDTLLSLQHPPTYTLGKRRTDHNLLISEAELKKLGAELHYTQRGGDITFHGPHQAILYPIISLRDIGLGARNYVEKLESTMIEIASLYGVKACPGQKGETGIWVGDRKIGAIGVRIQYGITSHGLAFNIDPDLNYFKHIVPCGIADKDVTSLRRETGAVRIFNTLEPLDSHKKNFIKISIKPQLSGVP
cccccEEEEEEcccccHHHHHHHHHHHHHHHHccccccEEEEEEcccCEEcccccccccccccHHHHHccccEEEEccccccccECccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHccccccccccccc
****RSLQIWRLGIVNYSDALKLQEKLVSDRKIHKISDTLLSLQHPPTYTLGKRRTDHNLLISEAELKKLGAELHYTQRGGDITFHGPHQAILYPIISLRDIGLGARNYVEKLESTMIEIASLYGVKACPGQKGETGIWVGDRKIGAIGVRIQYGITSHGLAFNIDPDLNYFKHIVPCGIADKDVTSLRRETGAVRIFNTLEPLDSHKKNFIKISIKPQ*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVPRSLQIWRLGIVNYSDALKLQEKLVSDRKIHKISDTLLSLQHPPTYTLGKRRTDHNLLISEAELKKLGAELHYTQRGGDITFHGPHQAILYPIISLRDIGLGARNYVEKLESTMIEIASLYGVKACPGQKGETGIWVGDRKIGAIGVRIQYGITSHGLAFNIDPDLNYFKHIVPCGIADKDVTSLRRETGAVRIFNTLEPLDSHKKNFIKISIKPQLSGVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Octanoyltransferase Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.confidentQ9SXP7
Octanoyltransferase Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.probableQ1IIJ5
Octanoyltransferase Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.probableA6TWD0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.181Lipoyl(octanoyl) transferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QHS, chain A
Confidence level:very confident
Coverage over the Query: 5-216
View the alignment between query and template
View the model in PyMOL