Citrus Sinensis ID: 027427

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MSSSSSPSVTTDAETLKRNRILSSKLYFDIPIFKLPLIYSPDYDISFLGIEKLHPFDSSKWGRICQFLSSEGFLDKNCIVEPLEASKEDLLVVHSESYLKSLQSSPNVSIIIEVPPVALFPNCLVQRKVLYPFRKQVGGTILAAKLAKERGWAINVGGGFHHCSADEGGGFCAYADISLCIHYAFVQLNISRVMIIDLDAHQGNGHEKDFSSDSRSCLYSGYV
ccccccccccccHHHHHHHHccccccccccccccccEEEcccccccccccccccccccHHHHHHHHHHHHccccccccEEccccccHHHHHccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHcccccEEEEEEcc
******************NRILSSKLYFDIPIFKLPLIYSPDYDISFLGIEKLHPFDSSKWGRICQFLSSEGFLDKNCIVEPLEASKEDLLVVHSESYLKSLQSSPNVSIIIEVPPVALFPNCLVQRKVLYPFRKQVGGTILAAKLAKERGWAINVGGGFHHCSADEGGGFCAYADISLCIHYAFVQLNISRVMIIDLDAHQGNGHEKDFSSDSRSCLYSGYV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSSSPSVTTDAETLKRNRILSSKLYFDIPIFKLPLIYSPDYDISFLGIEKLHPFDSSKWGRICQFLSSEGFLDKNCIVEPLEASKEDLLVVHSESYLKSLQSSPNVSIIIEVPPVALFPNCLVQRKVLYPFRKQVGGTILAAKLAKERGWAINVGGGFHHCSADEGGGFCAYADISLCIHYAFVQLNISRVMIIDLDAHQGNGHEKDFSSDSRSCLYSGYV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone deacetylase 2 Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.probableQ944K3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.5.-.-Acting on carbon-nitrogen bonds, other than peptide bonds.probable
3.5.1.-11-cis-retinol dehydrogenase.probable
3.5.1.98Histone deacetylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EW8, chain A
Confidence level:very confident
Coverage over the Query: 33-223
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2pqp, chain A very confident Alignment | Template Structure