Citrus Sinensis ID: 027431
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 223 | ||||||
| 359497262 | 203 | PREDICTED: uncharacterized protein At3g4 | 0.878 | 0.965 | 0.821 | 1e-89 | |
| 297819624 | 261 | hypothetical protein ARALYDRAFT_485334 [ | 0.869 | 0.743 | 0.8 | 2e-84 | |
| 18408931 | 261 | uncharacterized protein [Arabidopsis tha | 0.869 | 0.743 | 0.8 | 2e-84 | |
| 297797611 | 258 | hypothetical protein ARALYDRAFT_332797 [ | 0.852 | 0.736 | 0.773 | 1e-81 | |
| 147801370 | 256 | hypothetical protein VITISV_037838 [Viti | 0.847 | 0.738 | 0.779 | 2e-81 | |
| 21593192 | 258 | unknown [Arabidopsis thaliana] | 0.852 | 0.736 | 0.778 | 2e-81 | |
| 18424995 | 258 | uncharacterized protein [Arabidopsis tha | 0.852 | 0.736 | 0.778 | 3e-81 | |
| 9758568 | 219 | unnamed protein product [Arabidopsis tha | 0.852 | 0.867 | 0.778 | 7e-81 | |
| 449449222 | 258 | PREDICTED: uncharacterized protein At3g4 | 0.968 | 0.837 | 0.685 | 1e-80 | |
| 224105811 | 262 | predicted protein [Populus trichocarpa] | 0.937 | 0.797 | 0.672 | 1e-79 |
| >gi|359497262|ref|XP_002264014.2| PREDICTED: uncharacterized protein At3g49720-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 334 bits (857), Expect = 1e-89, Method: Compositional matrix adjust.
Identities = 161/196 (82%), Positives = 177/196 (90%)
Query: 1 MSRRPVSSTRRLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGD 60
MSRR V+ +RR VD+GS PF GAL SKSRSSPLLS+GLVL+GAFLL+ Y++SGSG+FGGD
Sbjct: 1 MSRRQVNPSRRFVDSGSIPFAGALHSKSRSSPLLSIGLVLLGAFLLVAYSYSGSGLFGGD 60
Query: 61 KAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGV 120
K A S++EGDFSCT E+QRAIPILKKAYGDSM KVLHVGPDTCSVVS LLKEEETEAWGV
Sbjct: 61 KEAFSKVEGDFSCTLEVQRAIPILKKAYGDSMRKVLHVGPDTCSVVSKLLKEEETEAWGV 120
Query: 121 EPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPD 180
EPYDIEDAD CKSLV K IVRVADIKFP+PYR KSF LVIVSDALDYLSPKYLNKTLPD
Sbjct: 121 EPYDIEDADGSCKSLVRKSIVRVADIKFPMPYRPKSFSLVIVSDALDYLSPKYLNKTLPD 180
Query: 181 LARVASDGVLIFAGIS 196
LARV+SDG++IFAG S
Sbjct: 181 LARVSSDGLVIFAGNS 196
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297819624|ref|XP_002877695.1| hypothetical protein ARALYDRAFT_485334 [Arabidopsis lyrata subsp. lyrata] gi|297323533|gb|EFH53954.1| hypothetical protein ARALYDRAFT_485334 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18408931|ref|NP_566924.1| uncharacterized protein [Arabidopsis thaliana] gi|145332799|ref|NP_001078265.1| uncharacterized protein [Arabidopsis thaliana] gi|75183398|sp|Q9M2Y6.1|Y3972_ARATH RecName: Full=Uncharacterized protein At3g49720 gi|6723417|emb|CAB66910.1| hypothetical protein [Arabidopsis thaliana] gi|21593048|gb|AAM64997.1| unknown [Arabidopsis thaliana] gi|222424727|dbj|BAH20317.1| AT3G49720 [Arabidopsis thaliana] gi|332645059|gb|AEE78580.1| uncharacterized protein [Arabidopsis thaliana] gi|332645060|gb|AEE78581.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297797611|ref|XP_002866690.1| hypothetical protein ARALYDRAFT_332797 [Arabidopsis lyrata subsp. lyrata] gi|297312525|gb|EFH42949.1| hypothetical protein ARALYDRAFT_332797 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|147801370|emb|CAN74732.1| hypothetical protein VITISV_037838 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|21593192|gb|AAM65141.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18424995|ref|NP_569020.1| uncharacterized protein [Arabidopsis thaliana] gi|110737950|dbj|BAF00912.1| hypothetical protein [Arabidopsis thaliana] gi|194579019|gb|ACF75543.1| At5g65810 [Arabidopsis thaliana] gi|332010727|gb|AED98110.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|9758568|dbj|BAB09049.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449449222|ref|XP_004142364.1| PREDICTED: uncharacterized protein At3g49720-like isoform 1 [Cucumis sativus] gi|449449224|ref|XP_004142365.1| PREDICTED: uncharacterized protein At3g49720-like isoform 2 [Cucumis sativus] gi|449492714|ref|XP_004159079.1| PREDICTED: uncharacterized protein At3g49720-like isoform 1 [Cucumis sativus] gi|449492718|ref|XP_004159080.1| PREDICTED: uncharacterized protein At3g49720-like isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224105811|ref|XP_002313939.1| predicted protein [Populus trichocarpa] gi|118483865|gb|ABK93823.1| unknown [Populus trichocarpa] gi|222850347|gb|EEE87894.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 223 | ||||||
| TAIR|locus:2097380 | 261 | AT3G49720 "AT3G49720" [Arabido | 0.869 | 0.743 | 0.717 | 3.3e-70 | |
| TAIR|locus:2156208 | 258 | CGR3 "AT5G65810" [Arabidopsis | 0.852 | 0.736 | 0.690 | 1.7e-66 |
| TAIR|locus:2097380 AT3G49720 "AT3G49720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 711 (255.3 bits), Expect = 3.3e-70, P = 3.3e-70
Identities = 140/195 (71%), Positives = 157/195 (80%)
Query: 1 MSRRPVSSTRRLVDTGSFPFTGALQSKSRXXXXXXXXXXXXXXXXXXXYAFSGSGIFGGD 60
M+RR V STRR+ D GSFPF GAL SKSR YA+SG GIF
Sbjct: 1 MARRQVGSTRRVGDGGSFPFAGALHSKSRSSPLLSICLVLVGACLLIGYAYSGPGIFKSI 60
Query: 61 KAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGV 120
K VS++ GD+SCT+E+QRAIP+LKKAYGD M KVLHVGPDTCSVVS+LLKEEETEAWGV
Sbjct: 61 KE-VSKVTGDYSCTAEVQRAIPVLKKAYGDGMRKVLHVGPDTCSVVSSLLKEEETEAWGV 119
Query: 121 EPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPD 180
EPYDIEDAD+ CKS V KG+VRVADIKFPLPYRAKSF LVIVSDALDYLSPKYLNKT+P+
Sbjct: 120 EPYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSPKYLNKTVPE 179
Query: 181 LARVASDGVLIFAGI 195
LARVASDGV++FAG+
Sbjct: 180 LARVASDGVVLFAGL 194
|
|
| TAIR|locus:2156208 CGR3 "AT5G65810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh2_kg.5__1326__AT3G49720.1 | annotation not avaliable (261 aa) | |||||||
(Arabidopsis lyrata) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 223 | |||
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 98.63 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 97.4 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 97.3 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 96.82 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 96.22 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 95.91 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 95.91 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 95.73 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 95.71 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 95.53 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 95.3 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 95.06 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 94.85 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 94.17 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 94.02 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 93.77 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 93.22 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 93.18 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 92.39 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 91.41 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 91.24 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 90.75 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 90.75 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 90.75 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 90.06 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 89.95 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 89.93 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 89.52 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 89.34 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 88.41 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 88.23 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 87.98 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 87.29 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 86.83 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 86.53 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 86.45 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 86.22 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 85.3 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 84.8 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 84.59 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 84.19 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 83.72 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 83.33 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 82.75 | |
| PF11899 | 380 | DUF3419: Protein of unknown function (DUF3419); In | 82.61 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 82.16 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 80.02 |
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
Probab=98.63 E-value=1.6e-08 Score=86.46 Aligned_cols=96 Identities=24% Similarity=0.412 Sum_probs=85.6
Q ss_pred cceeeeecCCcchhhhhccccccccccccccccccchhHHHHhhhhhcc-eeeeeecCCCC-CCCCCccEEEeccccccc
Q 027431 92 MHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGI-VRVADIKFPLP-YRAKSFPLVIVSDALDYL 169 (223)
Q Consensus 92 M~kVLHVGPdtC~VVs~LLkEeetEAWGVEPydiedad~~CKsLVrKGi-VRvADIkfpLP-YR~kSFSlVIVSDaLDyL 169 (223)
-.+||++|-........|.++.++++.|||-. +.+..+-|+||+ |--.|+.-.|+ |..+||+.||.|++|..+
T Consensus 14 gsrVLDLGCGdG~LL~~L~~~k~v~g~GvEid-----~~~v~~cv~rGv~Viq~Dld~gL~~f~d~sFD~VIlsqtLQ~~ 88 (193)
T PF07021_consen 14 GSRVLDLGCGDGELLAYLKDEKQVDGYGVEID-----PDNVAACVARGVSVIQGDLDEGLADFPDQSFDYVILSQTLQAV 88 (193)
T ss_pred CCEEEecCCCchHHHHHHHHhcCCeEEEEecC-----HHHHHHHHHcCCCEEECCHHHhHhhCCCCCccEEehHhHHHhH
Confidence 37999999999999999999999999999832 345777799999 99999999997 999999999999999998
Q ss_pred ChhhhccccccchhhccCceEEEee
Q 027431 170 SPKYLNKTLPDLARVASDGVLIFAG 194 (223)
Q Consensus 170 spryLNkTLPeLaRvsadglViF~G 194 (223)
++-.+.|-|+.||...++|-|.-
T Consensus 89 --~~P~~vL~EmlRVgr~~IVsFPN 111 (193)
T PF07021_consen 89 --RRPDEVLEEMLRVGRRAIVSFPN 111 (193)
T ss_pred --hHHHHHHHHHHHhcCeEEEEecC
Confidence 56778899999999999998763
|
Biosynthesis of methionine from homoserine in Pseudomonas putida takes place in three steps. The first step is the acylation of homoserine to yield an acyl-L-homoserine. This reaction is catalysed by the products of the metXW genes and is equivalent to the first step in enterobacteria, Gram-positive bacteria and fungi, except that in these microorganisms the reaction is catalysed by a single polypeptide (the product of the metA gene in Escherichia coli and the met5 gene product in Neurospora crassa). In P. putida, as in Gram-positive bacteria and certain fungi, the second and third steps are a direct sulphydrylation that converts the O-acyl-L-homoserine into homocysteine and further methylation to yield methionine. The latter reaction can be mediated by either of the two methionine synthetases present in the cells []. |
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 223 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 4e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 50.2 bits (119), Expect = 2e-07
Identities = 36/244 (14%), Positives = 73/244 (29%), Gaps = 63/244 (25%)
Query: 23 ALQSKSRSSPLLSV-GL------VLVGAFLL---IGYAFSGSGIF----GGDKAAVSRIE 68
AL + R + + + G+ + L + IF + + +E
Sbjct: 143 ALL-ELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDF-KIFWLNLKNCNSPETVLE 200
Query: 69 GDFSCTSEIQRAIPILKKAY---GDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPY-- 123
+Q+ + + + D + + + LLK + PY
Sbjct: 201 -------MLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSK--------PYEN 245
Query: 124 ------DIEDA------DARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSD------A 165
++++A + CK L+ +V D F L S
Sbjct: 246 CLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTD--FLSAATTTHISLDHHSMTLTPDEV 303
Query: 166 LDYLSPKYLNKTLPDLARVASDGV-LIFAGISSMFHLMKFSSDTW-----TEIHALMYTS 219
L KYL+ DL R + I+ + D W ++ ++ +S
Sbjct: 304 KSLLL-KYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESS 362
Query: 220 LDLQ 223
L++
Sbjct: 363 LNVL 366
|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 223 | |||
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 97.43 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 97.39 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 97.38 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 97.28 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 97.19 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 97.14 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 97.12 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 97.11 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 97.1 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 97.05 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 97.01 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 96.9 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 96.84 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 96.82 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 96.7 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 96.62 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 96.62 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 96.53 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 96.52 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 96.48 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 96.47 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 96.47 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 96.45 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 96.39 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 96.36 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 96.31 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 96.3 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 96.25 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 96.23 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 96.2 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 96.19 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 96.17 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 96.16 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 96.12 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 96.12 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 95.96 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 95.9 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 95.87 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 95.87 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 95.86 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 95.8 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 95.78 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 95.77 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 95.74 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 95.74 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 95.73 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 95.67 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 95.6 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 95.54 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 95.38 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 95.14 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 95.13 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 95.09 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 95.07 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 95.05 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 95.0 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 94.99 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 94.82 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 94.72 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 94.61 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 94.49 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 94.49 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 94.39 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 94.12 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 94.09 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 93.97 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 93.9 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 93.84 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 93.82 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 93.77 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 93.63 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 93.6 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 93.51 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 93.5 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 93.44 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 93.41 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 93.37 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 93.34 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 93.27 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 93.17 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 93.06 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 93.03 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 92.96 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 92.85 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 92.79 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 92.67 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 92.61 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 92.56 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 92.17 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 91.88 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 91.76 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 91.68 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 91.63 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 91.34 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 90.91 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 90.74 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 90.69 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 90.14 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 89.82 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 89.81 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 89.36 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 89.32 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 89.3 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 89.0 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 88.98 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 88.87 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 88.78 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 88.54 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 88.42 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 88.15 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 87.84 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 87.62 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 87.21 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 87.14 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 86.45 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 86.24 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 86.2 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 86.18 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 86.1 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 85.98 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 85.69 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 85.67 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 85.64 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 85.62 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 85.29 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 85.05 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 84.76 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 84.75 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 84.5 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 84.43 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 83.68 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 83.17 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 82.78 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 82.65 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 82.24 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 82.17 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 81.49 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 80.65 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 80.42 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 80.4 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 80.15 |
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
Probab=97.43 E-value=0.00024 Score=53.67 Aligned_cols=101 Identities=19% Similarity=0.183 Sum_probs=71.3
Q ss_pred cceeeeecCCcchhhhhcccccc-cccccccccc--ccchhHHHHhhh------hhcceeeeeecCCCCCCCCCccEEEe
Q 027431 92 MHKVLHVGPDTCSVVSTLLKEEE-TEAWGVEPYD--IEDADARCKSLV------HKGIVRVADIKFPLPYRAKSFPLVIV 162 (223)
Q Consensus 92 M~kVLHVGPdtC~VVs~LLkEee-tEAWGVEPyd--iedad~~CKsLV------rKGiVRvADIkfpLPYR~kSFSlVIV 162 (223)
-.+||.+|-.+......|.+... .+.+|||+.+ ++.+..+++..- .+=-+..+|+ ..+|....+|++|+.
T Consensus 30 ~~~vLDiGcG~G~~~~~l~~~~~~~~v~gvD~s~~~~~~a~~~~~~~~~~~~~~~~v~~~~~d~-~~~~~~~~~fD~V~~ 108 (219)
T 3jwg_A 30 AKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSL-VYRDKRFSGYDAATV 108 (219)
T ss_dssp CCEEEEETCTTCHHHHHHHTSTTCCEEEEEESCHHHHHHHHHHHTGGGSCHHHHTTEEEEECCS-SSCCGGGTTCSEEEE
T ss_pred CCEEEEecCCCCHHHHHHHhcCCCCEEEEEECCHHHHHHHHHHHHhhccccccCcceEEEeCcc-cccccccCCCCEEEE
Confidence 45999999999999888887654 6889998753 222333322110 0223455677 346777789999999
Q ss_pred cccccccChhhhccccccchhhccC-ceEEEe
Q 027431 163 SDALDYLSPKYLNKTLPDLARVASD-GVLIFA 193 (223)
Q Consensus 163 SDaLDyLspryLNkTLPeLaRvsad-glViF~ 193 (223)
++++.|+++..+.+.|-++.|+-.. |++|++
T Consensus 109 ~~~l~~~~~~~~~~~l~~~~~~LkpgG~~i~~ 140 (219)
T 3jwg_A 109 IEVIEHLDENRLQAFEKVLFEFTRPQTVIVST 140 (219)
T ss_dssp ESCGGGCCHHHHHHHHHHHHTTTCCSEEEEEE
T ss_pred HHHHHhCCHHHHHHHHHHHHHhhCCCEEEEEc
Confidence 9999999988888889999888665 544444
|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 223 | |||
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 97.6 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 97.29 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 96.88 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 96.56 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 96.5 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 96.34 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 95.93 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 95.87 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 95.42 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 95.18 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 95.15 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 94.78 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 94.73 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 94.67 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 93.7 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 92.82 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 92.65 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 91.77 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 91.31 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 90.72 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 85.52 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 83.75 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 83.33 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 82.99 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 82.41 |
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: CAC2371-like domain: Hypothetical protein PH0226 species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
Probab=97.60 E-value=3.7e-05 Score=55.83 Aligned_cols=113 Identities=25% Similarity=0.312 Sum_probs=78.3
Q ss_pred HHHhhhhHHHHHhccccceeeeecCCcchhhhhccccccccccccccccccchhHHHHhhhh-hc---ceeeeeecCCCC
Q 027431 76 EIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVH-KG---IVRVADIKFPLP 151 (223)
Q Consensus 76 eV~~aiP~LkkaYGdsM~kVLHVGPdtC~VVs~LLkEeetEAWGVEPydiedad~~CKsLVr-KG---iVRvADIkfpLP 151 (223)
+..+--|++++--.+. .+||-||-.|-...-.|-+ ...+.+|+++- ++.-..||...+ +| ....+|+. -||
T Consensus 23 ~~~~~~~~~~~~l~~~-~~ILDiGcG~G~~~~~la~-~~~~v~giD~S--~~~i~~ak~~~~~~~~~~~~~~~d~~-~l~ 97 (226)
T d1ve3a1 23 RIETLEPLLMKYMKKR-GKVLDLACGVGGFSFLLED-YGFEVVGVDIS--EDMIRKAREYAKSRESNVEFIVGDAR-KLS 97 (226)
T ss_dssp HHHHHHHHHHHSCCSC-CEEEEETCTTSHHHHHHHH-TTCEEEEEESC--HHHHHHHHHHHHHTTCCCEEEECCTT-SCC
T ss_pred HHHHHHHHHHHhcCCC-CEEEEECCCcchhhhhHhh-hhccccccccc--ccchhhhhhhhccccccccccccccc-ccc
Confidence 4555566777644444 5799999999886665554 45688998864 233334443332 22 23344443 378
Q ss_pred CCCCCccEEEecccccccChhhhccccccchhhccC-ceEEEe
Q 027431 152 YRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASD-GVLIFA 193 (223)
Q Consensus 152 YR~kSFSlVIVSDaLDyLspryLNkTLPeLaRvsad-glViF~ 193 (223)
+...||++|+..+.+.|+++.-+++.|=+++|+-.. |..|+.
T Consensus 98 ~~~~~fD~I~~~~~l~~~~~~d~~~~l~~i~~~LkpgG~lii~ 140 (226)
T d1ve3a1 98 FEDKTFDYVIFIDSIVHFEPLELNQVFKEVRRVLKPSGKFIMY 140 (226)
T ss_dssp SCTTCEEEEEEESCGGGCCHHHHHHHHHHHHHHEEEEEEEEEE
T ss_pred ccCcCceEEEEecchhhCChhHHHHHHHHHHHHcCcCcEEEEE
Confidence 888999999999999999999999999999998554 555544
|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|