Citrus Sinensis ID: 027432


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MMNLPQAVPAPSRNMAVPPPASNGPTVVKSRMCNRLNSAEGCKFGDKCHFAHGEWELGKPIAISHDDPRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVRIGPAHAKNPATAGSAAHPLSSNFKTKLCGNFAKGSCTFGDRCHFAHGAAELRKTAI
ccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccEEEcccccccHHHHHHcccEEEEEccccccccCEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccc
********************************CNRLNSAEGCKFGDKCHFAHGEWELGKPIAI*********************************SATAKISVDASLAGAIIGKGGVNSKQICRQTGAKL*I********LRNIELEGSFEQIKQASAMVRELIVRIGPAHA***************NFKTKLCGNFAKGSCTFGDRCHFAHGAA*L*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMNLPQAVPAPSRNMAVPPPASNGPTVVKSRMCNRLNSAEGCKFGDKCHFAHGEWELGKPIAISHDDPRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVRIGPAHAKNPATAGSAAHPLSSNFKTKLCGNFAKGSCTFGDRCHFAHGAAELRKTAI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCCH domain-containing protein 44 probableQ69XQ3
Zinc finger CCCH domain-containing protein 52 probableQ9FG30

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 25-59
View the alignment between query and template
View the model in PyMOL
Template: 1J4W, chain A
Confidence level:very confident
Coverage over the Query: 97-169
View the alignment between query and template
View the model in PyMOL
Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 187-220
View the alignment between query and template
View the model in PyMOL