Query         027449
Match_columns 223
No_of_seqs    201 out of 1103
Neff          7.2 
Searched_HMMs 46136
Date          Fri Mar 29 10:05:30 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/027449.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/027449hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03156 GDSL esterase/lipase; 100.0 4.1E-48 8.8E-53  348.0  19.1  182   42-223    25-206 (351)
  2 cd01837 SGNH_plant_lipase_like 100.0 4.9E-42 1.1E-46  303.7  16.4  175   45-223     1-175 (315)
  3 cd01847 Triacylglycerol_lipase 100.0 5.5E-31 1.2E-35  229.5  12.1  148   44-223     1-152 (281)
  4 PRK15381 pathogenicity island  100.0 3.5E-30 7.5E-35  234.8  12.6  131   41-223   139-272 (408)
  5 cd01846 fatty_acyltransferase_  99.9 9.5E-26   2E-30  194.7  12.0  139   46-222     1-141 (270)
  6 COG3240 Phospholipase/lecithin  99.2 2.9E-11 6.2E-16  108.1   6.7  142   40-190    25-177 (370)
  7 PF00657 Lipase_GDSL:  GDSL-lik  99.1 4.3E-10 9.2E-15   93.1   9.2  122   47-222     1-123 (234)
  8 cd01839 SGNH_arylesterase_like  96.7  0.0076 1.6E-07   49.7   7.8   75   86-189    20-94  (208)
  9 cd01823 SEST_like SEST_like. A  96.1   0.015 3.2E-07   49.6   6.0   61   46-136     2-62  (259)
 10 cd01832 SGNH_hydrolase_like_1   95.9   0.066 1.4E-06   42.9   8.9   52   46-133     1-52  (185)
 11 cd01824 Phospholipase_B_like P  94.6    0.59 1.3E-05   41.2  11.3  126   41-189     7-134 (288)
 12 cd01827 sialate_O-acetylestera  94.6    0.21 4.5E-06   40.1   7.9   14  175-188    68-81  (188)
 13 cd01844 SGNH_hydrolase_like_6   94.4    0.11 2.4E-06   41.6   6.0   25   91-133    20-44  (177)
 14 cd04501 SGNH_hydrolase_like_4   94.1    0.31 6.6E-06   39.0   8.0   14  175-188    60-73  (183)
 15 cd01830 XynE_like SGNH_hydrola  94.1    0.43 9.3E-06   39.2   8.9   14  176-189    76-89  (204)
 16 cd01825 SGNH_hydrolase_peri1 S  93.7   0.085 1.8E-06   42.2   3.9   13  176-188    58-70  (189)
 17 cd01831 Endoglucanase_E_like E  93.4    0.59 1.3E-05   37.1   8.4   45   46-104     1-45  (169)
 18 cd01822 Lysophospholipase_L1_l  93.3    0.65 1.4E-05   36.6   8.4   14  175-188    65-78  (177)
 19 PF13472 Lipase_GDSL_2:  GDSL-l  93.2     1.1 2.3E-05   34.6   9.4   16  174-189    61-76  (179)
 20 KOG3670 Phospholipase [Lipid t  93.2     0.5 1.1E-05   43.3   8.3   19   42-61     73-91  (397)
 21 PRK10528 multifunctional acyl-  92.7    0.91   2E-05   37.0   8.6   14  175-188    72-85  (191)
 22 cd01836 FeeA_FeeB_like SGNH_hy  92.0    0.93   2E-05   36.4   7.9   15  174-188    67-81  (191)
 23 cd01835 SGNH_hydrolase_like_3   90.8     2.3 4.9E-05   34.2   8.9   16  174-189    69-84  (193)
 24 cd01821 Rhamnogalacturan_acety  90.4     3.1 6.8E-05   33.7   9.5   15  175-189    66-80  (198)
 25 cd01838 Isoamyl_acetate_hydrol  89.8     0.8 1.7E-05   36.6   5.5   16  174-189    63-78  (199)
 26 COG2755 TesA Lysophospholipase  81.9     6.6 0.00014   32.1   7.1   14  175-188    78-91  (216)
 27 PF14606 Lipase_GDSL_3:  GDSL-l  77.7      16 0.00034   30.1   7.9   45   45-133     2-46  (178)
 28 cd04506 SGNH_hydrolase_YpmR_li  54.7      19  0.0004   29.1   4.0   18  174-191    68-85  (204)
 29 PF09680 Tiny_TM_bacill:  Prote  52.9      14 0.00031   20.2   1.9   20   14-33      4-23  (24)
 30 cd01834 SGNH_hydrolase_like_2   50.4      23  0.0005   27.7   3.8   16  175-190    62-77  (191)
 31 cd01829 SGNH_hydrolase_peri2 S  33.5      75  0.0016   25.2   4.4   14  176-189    61-74  (200)
 32 TIGR01732 tiny_TM_bacill conse  33.3      51  0.0011   18.4   2.2   19   14-32      6-24  (26)
 33 PF03996 Hema_esterase:  Hemagg  32.1      30 0.00065   29.6   1.7   17   45-61     45-64  (258)
 34 cd04502 SGNH_hydrolase_like_7   31.7      46   0.001   25.9   2.7   14  175-188    51-64  (171)
 35 cd00229 SGNH_hydrolase SGNH_hy  30.5      61  0.0013   24.1   3.2   17  173-189    64-80  (187)
 36 cd01833 XynB_like SGNH_hydrola  28.6      56  0.0012   24.9   2.7   16  174-189    40-55  (157)
 37 cd01820 PAF_acetylesterase_lik  26.7      56  0.0012   26.7   2.5   14  175-188    90-103 (214)
 38 PF02896 PEP-utilizers_C:  PEP-  26.0      76  0.0016   28.1   3.3   47  174-220   195-243 (293)
 39 PF08282 Hydrolase_3:  haloacid  24.0      40 0.00087   27.4   1.2   14   45-58    203-216 (254)
 40 PRK03669 mannosyl-3-phosphogly  21.3      58  0.0012   27.8   1.6   17   44-60    206-222 (271)
 41 KOG3035 Isoamyl acetate-hydrol  21.2      63  0.0014   27.7   1.8   20   42-61      4-23  (245)
 42 TIGR01486 HAD-SF-IIB-MPGP mann  20.2      57  0.0012   27.5   1.4   18   44-61    194-211 (256)
 43 cd01841 NnaC_like NnaC (CMP-Ne  20.0 1.8E+02  0.0039   22.4   4.2   13  176-188    53-65  (174)

No 1  
>PLN03156 GDSL esterase/lipase; Provisional
Probab=100.00  E-value=4.1e-48  Score=348.02  Aligned_cols=182  Identities=44%  Similarity=0.784  Sum_probs=155.0

Q ss_pred             CCCCEEEEeCCchhhcCCCCCcccccccCCCCCCCCCCCCCCcccCCCCChhHHHHHHHhCCCCCCCCcCCCCCCCCCCC
Q 027449           42 ESVPAVFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGIKELLPAYLDPNLKPQDLV  121 (223)
Q Consensus        42 ~~~~~lfvFGDSlsDtGn~~~~~~~~~~~~~PyG~~~~~~~ptGRfSnG~~~~D~la~~lgl~~~~ppyl~~~~~~~~~~  121 (223)
                      ..+++|||||||++|+||++++.+..+++++|||++||+++|||||||||+|+||||+.||+++++|||+++..+..++.
T Consensus        25 ~~~~aifvFGDSl~D~GN~~~l~~~~~~~~~pyG~~f~~~~ptGRfSnGr~~~D~iA~~lGl~p~~ppyl~~~~~~~~~~  104 (351)
T PLN03156         25 AKVPAIIVFGDSSVDAGNNNQISTVAKSNFEPYGRDFPGGRPTGRFCNGRIAPDFISEAFGLKPAIPAYLDPSYNISDFA  104 (351)
T ss_pred             CCCCEEEEecCcCccCCCccccccccccCCCCCCCCCCCCCCCccccCCChhhhhHHHHhCCCCCCCCCcCcccCchhhc
Confidence            45899999999999999998876556788999999999878999999999999999999999448999998765566899


Q ss_pred             CcceeeeecCCcCCCCCccccCCCHHHHHHHHHHHHHHHHHhhChHHHhhhhcCcEEEEEeccchhhhhhccCCCCCCcc
Q 027449          122 TGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQY  201 (223)
Q Consensus       122 ~G~NFA~gGA~~~~~~~~~~~~~sl~~Qv~~F~~~~~~l~~~~g~~~~~~~~~~sLf~i~iG~NDy~~~~~~~~~~~~~~  201 (223)
                      +|+|||+||+++++.+......++|..||+||+++++++....|.+.+++.++++||+||||+|||+.+|+..+......
T Consensus       105 ~GvNFA~agag~~~~~~~~~~~~~l~~Qv~~F~~~~~~l~~~~g~~~~~~~~~~sL~~i~iG~NDy~~~~~~~~~~~~~~  184 (351)
T PLN03156        105 TGVCFASAGTGYDNATSDVLSVIPLWKELEYYKEYQTKLRAYLGEEKANEIISEALYLISIGTNDFLENYYTFPGRRSQY  184 (351)
T ss_pred             ccceeecCCccccCCCccccCccCHHHHHHHHHHHHHHHHHhhChHHHHHHHhcCeEEEEecchhHHHHhhccccccccC
Confidence            99999999999987665333467899999999999998887777766778899999999999999987665322222334


Q ss_pred             ChhhHHHHHHHHHHHHHHHHhC
Q 027449          202 DINSYTDLTASSALSFLQVCYI  223 (223)
Q Consensus       202 ~~~~~v~~vv~~i~~~i~~LY~  223 (223)
                      ++++|++.|++.+++.|++||+
T Consensus       185 ~~~~~~~~lv~~~~~~i~~Ly~  206 (351)
T PLN03156        185 TVSQYQDFLIGIAENFVKKLYR  206 (351)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHH
Confidence            6789999999999999999984


No 2  
>cd01837 SGNH_plant_lipase_like SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=100.00  E-value=4.9e-42  Score=303.72  Aligned_cols=175  Identities=49%  Similarity=0.787  Sum_probs=146.9

Q ss_pred             CEEEEeCCchhhcCCCCCcccccccCCCCCCCCCCCCCCcccCCCCChhHHHHHHHhCCCCCCCCcCCCCCCCCCCCCcc
Q 027449           45 PAVFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGIKELLPAYLDPNLKPQDLVTGV  124 (223)
Q Consensus        45 ~~lfvFGDSlsDtGn~~~~~~~~~~~~~PyG~~~~~~~ptGRfSnG~~~~D~la~~lgl~~~~ppyl~~~~~~~~~~~G~  124 (223)
                      ++||+||||++|+||+.++.+..+++.+|||++||+ +|+||||||++|+|+||+.||+|..+|||+..... .++.+|+
T Consensus         1 ~al~vFGDS~sD~Gn~~~~~~~~~~~~~PyG~~~~~-~p~GRfSnG~~~~d~la~~lgl~~~~p~~~~~~~~-~~~~~G~   78 (315)
T cd01837           1 PALFVFGDSLVDTGNNNYLPTLAKANFPPYGIDFPG-RPTGRFSNGRLIIDFIAEALGLPLLPPPYLSPNGS-SDFLTGV   78 (315)
T ss_pred             CcEEEecCccccCCCccccccccccCCCCCcCcCCC-CCCccccCCchhhhhhhhhccCCCCCCCccCcccc-chhhccc
Confidence            479999999999999987654445789999999997 69999999999999999999999437788775322 5688999


Q ss_pred             eeeeecCCcCCCCCccccCCCHHHHHHHHHHHHHHHHHhhChHHHhhhhcCcEEEEEeccchhhhhhccCCCCCCccChh
Q 027449          125 SFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDIN  204 (223)
Q Consensus       125 NFA~gGA~~~~~~~~~~~~~sl~~Qv~~F~~~~~~l~~~~g~~~~~~~~~~sLf~i~iG~NDy~~~~~~~~~~~~~~~~~  204 (223)
                      |||+|||++.+.+.....+++|..||++|++++++++..+|++++.+..+++||+||||+|||+..+.....  ...++.
T Consensus        79 NfA~gGA~~~~~~~~~~~~~~l~~Qv~~F~~~~~~~~~~~g~~~~~~~~~~sL~~i~iG~ND~~~~~~~~~~--~~~~~~  156 (315)
T cd01837          79 NFASGGAGILDSTGFLGSVISLSVQLEYFKEYKERLRALVGEEAAADILSKSLFLISIGSNDYLNNYFANPT--RQYEVE  156 (315)
T ss_pred             eecccCCccccCCcceeeeecHHHHHHHHHHHHHHHHHhhCHHHHHHHHhCCEEEEEecccccHHHHhcCcc--ccCCHH
Confidence            999999999876643234689999999999999988888887777788999999999999999976643221  034678


Q ss_pred             hHHHHHHHHHHHHHHHHhC
Q 027449          205 SYTDLTASSALSFLQVCYI  223 (223)
Q Consensus       205 ~~v~~vv~~i~~~i~~LY~  223 (223)
                      ++++.+|+++.++|++||+
T Consensus       157 ~~~~~~v~~i~~~v~~L~~  175 (315)
T cd01837         157 AYVPFLVSNISSAIKRLYD  175 (315)
T ss_pred             HHHHHHHHHHHHHHHHHHh
Confidence            9999999999999999985


No 3  
>cd01847 Triacylglycerol_lipase_like Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
Probab=99.97  E-value=5.5e-31  Score=229.53  Aligned_cols=148  Identities=20%  Similarity=0.172  Sum_probs=114.6

Q ss_pred             CCEEEEeCCchhhcCCCCCcccccccCCCCCCCCCCCCCCcccCCCCChhHHHHHHHhCCCCCCCCcCCCCCCCCCCCCc
Q 027449           44 VPAVFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGIKELLPAYLDPNLKPQDLVTG  123 (223)
Q Consensus        44 ~~~lfvFGDSlsDtGn~~~~~~~~~~~~~PyG~~~~~~~ptGRfSnG~~~~D~la~~lgl~~~~ppyl~~~~~~~~~~~G  123 (223)
                      |++||+||||++|+||++++.        +    +  ++|+|||||||+++|++++.+|++ .+   +.+  ...+..+|
T Consensus         1 ~~~i~vFGDSl~D~Gn~~~~~--------~----~--~~~~gRFsnG~~~~d~~~~~~~~~-~~---~~~--~~~~~~~G   60 (281)
T cd01847           1 FSRVVVFGDSLSDVGTYNRAG--------V----G--AAGGGRFTVNDGSIWSLGVAEGYG-LT---TGT--ATPTTPGG   60 (281)
T ss_pred             CCceEEecCcccccCCCCccc--------c----C--CCCCcceecCCcchHHHHHHHHcC-CC---cCc--CcccCCCC
Confidence            578999999999999998652        1    1  258999999999999999999987 33   222  24567899


Q ss_pred             ceeeeecCCcCCCCCcc---ccCCCHHHHHHHHHHHHHHHHHhhChHHHhhhhcCcEEEEEeccchhhhhhccCCC-CCC
Q 027449          124 VSFASGGAGYDPLTSKV---ASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPF-RRG  199 (223)
Q Consensus       124 ~NFA~gGA~~~~~~~~~---~~~~sl~~Qv~~F~~~~~~l~~~~g~~~~~~~~~~sLf~i~iG~NDy~~~~~~~~~-~~~  199 (223)
                      +|||+|||++.+.+...   ...++|.+||++|++.+.            ..++++||+||||+|||+..+..... ...
T Consensus        61 ~NfA~gGa~~~~~~~~~~~~~~~~~l~~Qv~~f~~~~~------------~~~~~sL~~i~iG~ND~~~~~~~~~~~~~~  128 (281)
T cd01847          61 TNYAQGGARVGDTNNGNGAGAVLPSVTTQIANYLAAGG------------GFDPNALYTVWIGGNDLIAALAALTTATTT  128 (281)
T ss_pred             ceeeccCccccCCCCccccccCCCCHHHHHHHHHHhcC------------CCCCCeEEEEecChhHHHHHHhhccccccc
Confidence            99999999998755321   235799999999986542            24789999999999999976643221 011


Q ss_pred             ccChhhHHHHHHHHHHHHHHHHhC
Q 027449          200 QYDINSYTDLTASSALSFLQVCYI  223 (223)
Q Consensus       200 ~~~~~~~v~~vv~~i~~~i~~LY~  223 (223)
                      ..++.++++.+++.+..++++||+
T Consensus       129 ~~~~~~~~~~~~~~~~~~v~~L~~  152 (281)
T cd01847         129 QAAAVAAAATAAADLASQVKNLLD  152 (281)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHH
Confidence            245678999999999999999984


No 4  
>PRK15381 pathogenicity island 2 effector protein SseJ; Provisional
Probab=99.97  E-value=3.5e-30  Score=234.76  Aligned_cols=131  Identities=20%  Similarity=0.335  Sum_probs=103.5

Q ss_pred             CCCCCEEEEeCCchhhcCCCCCcccccccCCCCCCCCCCCCCCcccCCCCChhHHHHHHHhCCCCCCCCcCCCCCCCCCC
Q 027449           41 NESVPAVFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGIKELLPAYLDPNLKPQDL  120 (223)
Q Consensus        41 ~~~~~~lfvFGDSlsDtGn~~~~~~~~~~~~~PyG~~~~~~~ptGRfSnG~~~~D~la~~lgl~~~~ppyl~~~~~~~~~  120 (223)
                      -..+++||+||||++|+||+.+..+.  ..+||||++|     +|||||||+|+||||        +|||++.       
T Consensus       139 ~~~~~ai~vFGDSlsDtGnn~y~~t~--~~~PPyG~~f-----tGRFSNG~v~~DfLA--------~~pyl~~-------  196 (408)
T PRK15381        139 LGDITRLVFFGDSLSDSLGRMFEKTH--HILPSYGQYF-----GGRFTNGFTWTEFLS--------SPHFLGK-------  196 (408)
T ss_pred             cCCCCeEEEeCCccccCCCccccccc--cCCCCCCCCC-----CcccCCCchhhheec--------cccccCC-------
Confidence            35789999999999999988765432  4689999987     799999999999999        2567642       


Q ss_pred             CCcceeeeecCCcCCCCCc--c-ccCCCHHHHHHHHHHHHHHHHHhhChHHHhhhhcCcEEEEEeccchhhhhhccCCCC
Q 027449          121 VTGVSFASGGAGYDPLTSK--V-ASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFR  197 (223)
Q Consensus       121 ~~G~NFA~gGA~~~~~~~~--~-~~~~sl~~Qv~~F~~~~~~l~~~~g~~~~~~~~~~sLf~i~iG~NDy~~~~~~~~~~  197 (223)
                       +|+|||+|||++......  . ...++|.+||++|+.                 -+++||+||+|+|||+. |      
T Consensus       197 -~G~NFA~GGA~~~t~~~~~~~~~~~~~L~~Qv~~~~~-----------------~~~aL~lV~iG~NDy~~-~------  251 (408)
T PRK15381        197 -EMLNFAEGGSTSASYSCFNCIGDFVSNTDRQVASYTP-----------------SHQDLAIFLLGANDYMT-L------  251 (408)
T ss_pred             -CCceEeecccccccccccccccCccCCHHHHHHHHHh-----------------cCCcEEEEEeccchHHH-h------
Confidence             699999999998732110  0 124689999998542                 16799999999999973 3      


Q ss_pred             CCccChhhHHHHHHHHHHHHHHHHhC
Q 027449          198 RGQYDINSYTDLTASSALSFLQVCYI  223 (223)
Q Consensus       198 ~~~~~~~~~v~~vv~~i~~~i~~LY~  223 (223)
                           ..++++.||+++..+|++||+
T Consensus       252 -----~~~~v~~vV~~~~~~l~~Ly~  272 (408)
T PRK15381        252 -----HKDNVIMVVEQQIDDIEKIIS  272 (408)
T ss_pred             -----HHHHHHHHHHHHHHHHHHHHH
Confidence                 234788999999999999984


No 5  
>cd01846 fatty_acyltransferase_like Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
Probab=99.93  E-value=9.5e-26  Score=194.67  Aligned_cols=139  Identities=26%  Similarity=0.365  Sum_probs=105.7

Q ss_pred             EEEEeCCchhhcCCCCCcccccccCCCCCCCCCCCCCCcccCCCCChhHHHHHHHhCCCCCCCCcCCCCCCCCCCCCcce
Q 027449           46 AVFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGIKELLPAYLDPNLKPQDLVTGVS  125 (223)
Q Consensus        46 ~lfvFGDSlsDtGn~~~~~~~~~~~~~PyG~~~~~~~ptGRfSnG~~~~D~la~~lgl~~~~ppyl~~~~~~~~~~~G~N  125 (223)
                      ++|+||||++|+||+.++...   ..+|.+..    .|+||||||++|+|+||+.+|++ .             ..+|+|
T Consensus         1 ~l~vFGDS~sD~Gn~~~~~~~---~~~~~~~~----~~~grfsnG~~w~d~la~~lg~~-~-------------~~~~~N   59 (270)
T cd01846           1 RLVVFGDSLSDTGNIFKLTGG---SNPPPSPP----YFGGRFSNGPVWVEYLAATLGLS-G-------------LKQGYN   59 (270)
T ss_pred             CeEEeeCccccCCcchhhcCC---CCCCCCCC----CCCCccCCchhHHHHHHHHhCCC-c-------------cCCcce
Confidence            489999999999998754321   12333322    36899999999999999999986 2             246899


Q ss_pred             eeeecCCcCCCCCc--cccCCCHHHHHHHHHHHHHHHHHhhChHHHhhhhcCcEEEEEeccchhhhhhccCCCCCCccCh
Q 027449          126 FASGGAGYDPLTSK--VASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDI  203 (223)
Q Consensus       126 FA~gGA~~~~~~~~--~~~~~sl~~Qv~~F~~~~~~l~~~~g~~~~~~~~~~sLf~i~iG~NDy~~~~~~~~~~~~~~~~  203 (223)
                      ||+|||++.+....  .....++..||++|++..+.           +..+++|++|++|+||+...+..      ....
T Consensus        60 ~A~~Ga~~~~~~~~~~~~~~~~l~~Qv~~f~~~~~~-----------~~~~~~l~~i~~G~ND~~~~~~~------~~~~  122 (270)
T cd01846          60 YAVGGATAGAYNVPPYPPTLPGLSDQVAAFLAAHKL-----------RLPPDTLVAIWIGANDLLNALDL------PQNP  122 (270)
T ss_pred             eEecccccCCcccCCCCCCCCCHHHHHHHHHHhccC-----------CCCCCcEEEEEeccchhhhhccc------cccc
Confidence            99999998765431  12357999999999876532           34688999999999999864422      1345


Q ss_pred             hhHHHHHHHHHHHHHHHHh
Q 027449          204 NSYTDLTASSALSFLQVCY  222 (223)
Q Consensus       204 ~~~v~~vv~~i~~~i~~LY  222 (223)
                      .++++.+++++.+.|++||
T Consensus       123 ~~~~~~~~~~~~~~i~~l~  141 (270)
T cd01846         123 DTLVTRAVDNLFQALQRLY  141 (270)
T ss_pred             cccHHHHHHHHHHHHHHHH
Confidence            5788899999999999997


No 6  
>COG3240 Phospholipase/lecithinase/hemolysin [Lipid metabolism / General function prediction only]
Probab=99.20  E-value=2.9e-11  Score=108.09  Aligned_cols=142  Identities=24%  Similarity=0.281  Sum_probs=85.6

Q ss_pred             CCCCCCEEEEeCCchhhcCCCCCcccccccCCC-CCCCCCCCCCCcccCCC--CChhHHHHHHHhCCCCCCCCc----CC
Q 027449           40 KNESVPAVFVFGDSIADPGNNNNIKTIIKCNFP-PYGRDFKGKIATGRFSN--GVIPSDLIAQEFGIKELLPAY----LD  112 (223)
Q Consensus        40 ~~~~~~~lfvFGDSlsDtGn~~~~~~~~~~~~~-PyG~~~~~~~ptGRfSn--G~~~~D~la~~lgl~~~~ppy----l~  112 (223)
                      ..++|+.+.||||||||+|+.......  ...+ -||     .+|..++.+  |..|++..++.||.-...+.+    .+
T Consensus        25 ~~~~~~~l~vfGDSlSDsg~~~~~a~~--~~~~~~~~-----~~~gp~~~~G~~~~~~~~~p~~lg~l~~~~~~~~~~~~   97 (370)
T COG3240          25 SLAPFQRLVVFGDSLSDSGNYYRPAGH--HGDPGSYG-----TIPGPSYQNGNGYTYVTVVPETLGQLGVNHDFTYAAAD   97 (370)
T ss_pred             cccccceEEEeccchhhcccccCcccc--cCCccccc-----cccCCcccCCCceeeeccchhhhccccccccccccccC
Confidence            346899999999999999997533110  0111 122     123344554  677888888888811001111    12


Q ss_pred             CCCCCCCCCCcceeeeecCCcCCCC---CccccCCCHHHHHHHHHHHHHHHHHhhCh-HHHhhhhcCcEEEEEeccchhh
Q 027449          113 PNLKPQDLVTGVSFASGGAGYDPLT---SKVASALSMSDQLDLFKKALETIKATAGE-EATANILSKGLFMVVSGSDDIA  188 (223)
Q Consensus       113 ~~~~~~~~~~G~NFA~gGA~~~~~~---~~~~~~~sl~~Qv~~F~~~~~~l~~~~g~-~~~~~~~~~sLf~i~iG~NDy~  188 (223)
                      +.........|.|||+|||++...+   .......++.+|+.+|+.......  +.. ..........|+.+|.|+|||+
T Consensus        98 ~~~~~~~~a~gnd~A~gga~~~~~~~~~~i~~~~~~~~~Qv~~~l~a~~~~~--v~~~~~~~~l~p~~l~~~~ggand~~  175 (370)
T COG3240          98 PNGLYIHWAGGNDLAVGGARSTEPNTGNSIGASATSLAQQVGAFLAAGQGGF--VWPNYPAQGLDPSALYFLWGGANDYL  175 (370)
T ss_pred             cccccCcccccccHhhhccccccccccccccccccchHHHHHHHHHhcCCcc--ccccccccccCHHHHHHHhhcchhhh
Confidence            2222222367999999999976554   112346799999999987664310  000 0112234678899999999997


Q ss_pred             hh
Q 027449          189 NT  190 (223)
Q Consensus       189 ~~  190 (223)
                      ..
T Consensus       176 ~~  177 (370)
T COG3240         176 AL  177 (370)
T ss_pred             cc
Confidence            53


No 7  
>PF00657 Lipase_GDSL:  GDSL-like Lipase/Acylhydrolase;  InterPro: IPR001087 A variety of lipolytic enzymes with serine as part of the active site have been identified []. Members of this entry include; Aeromonas hydrophila lipase, Vibrio mimicus arylesterase, Vibrio parahaemolyticus thermolabile haemolysin, rabbit phospholipase (AdRab-B), and Brassica napus anter-specific proline-rich protein.; GO: 0016788 hydrolase activity, acting on ester bonds, 0006629 lipid metabolic process; PDB: 2WAO_A 2WAB_A 1V2G_A 1U8U_A 1JRL_A 1IVN_A 1J00_A 1DEO_A 1K7C_A 1PP4_A ....
Probab=99.10  E-value=4.3e-10  Score=93.11  Aligned_cols=122  Identities=21%  Similarity=0.192  Sum_probs=71.2

Q ss_pred             EEEeCCchhhcCCCCCcccccccCCCCCCCCCCCCCCcccCCCCChhHHHHHHHhCCCCCCCCcCCCCCCCCCCCCccee
Q 027449           47 VFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGIKELLPAYLDPNLKPQDLVTGVSF  126 (223)
Q Consensus        47 lfvFGDSlsDtGn~~~~~~~~~~~~~PyG~~~~~~~ptGRfSnG~~~~D~la~~lgl~~~~ppyl~~~~~~~~~~~G~NF  126 (223)
                      |++||||++|.                           +|+++|..|.+.++..+.-. ....+      ...-..+.|+
T Consensus         1 i~~fGDS~td~---------------------------~~~~~~~~~~~~~~~~l~~~-~~~~~------~~~~~~~~n~   46 (234)
T PF00657_consen    1 IVVFGDSLTDG---------------------------GGDSNGGGWPEGLANNLSSC-LGANQ------RNSGVDVSNY   46 (234)
T ss_dssp             EEEEESHHHHT---------------------------TTSSTTCTHHHHHHHHCHHC-CHHHH------HCTTEEEEEE
T ss_pred             CEEEeehhccc---------------------------CCCCCCcchhhhHHHHHhhc-ccccc------CCCCCCeecc
Confidence            68999999998                           36788999999999987221 00000      0012347899


Q ss_pred             eeecCCcCCCCCccc-cCCCHHHHHHHHHHHHHHHHHhhChHHHhhhhcCcEEEEEeccchhhhhhccCCCCCCccChhh
Q 027449          127 ASGGAGYDPLTSKVA-SALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINS  205 (223)
Q Consensus       127 A~gGA~~~~~~~~~~-~~~sl~~Qv~~F~~~~~~l~~~~g~~~~~~~~~~sLf~i~iG~NDy~~~~~~~~~~~~~~~~~~  205 (223)
                      |.+|+++........ ....+..|+.....             .....+..|++|++|+||++.  .     ........
T Consensus        47 a~~G~~~~~~~~~~~~~~~~~~~~~~~~~~-------------~~~~~~~~lv~i~~G~ND~~~--~-----~~~~~~~~  106 (234)
T PF00657_consen   47 AISGATSDGDLYNLWAQVQNISQQISRLLD-------------SKSFYDPDLVVIWIGTNDYFN--N-----RDSSDNNT  106 (234)
T ss_dssp             E-TT--CC-HGGCCCCTCHHHHHHHHHHHH-------------HHHHHTTSEEEEE-SHHHHSS--C-----CSCSTTHH
T ss_pred             ccCCCccccccchhhHHHHHHHHHhhcccc-------------ccccCCcceEEEecccCcchh--h-----cccchhhh
Confidence            999998653221000 01112222222111             122357789999999999874  1     11234567


Q ss_pred             HHHHHHHHHHHHHHHHh
Q 027449          206 YTDLTASSALSFLQVCY  222 (223)
Q Consensus       206 ~v~~vv~~i~~~i~~LY  222 (223)
                      .++.+++.+++.|++|+
T Consensus       107 ~~~~~~~~~~~~i~~l~  123 (234)
T PF00657_consen  107 SVEEFVENLRNAIKRLR  123 (234)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             hHhhHhhhhhhhhhHHh
Confidence            78888888899888875


No 8  
>cd01839 SGNH_arylesterase_like SGNH_hydrolase subfamily, similar to arylesterase (7-aminocephalosporanic acid-deacetylating enzyme) of A. tumefaciens. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=96.72  E-value=0.0076  Score=49.70  Aligned_cols=75  Identities=15%  Similarity=0.150  Sum_probs=41.9

Q ss_pred             cCCCCChhHHHHHHHhCCCCCCCCcCCCCCCCCCCCCcceeeeecCCcCCCCCccccCCCHHHHHHHHHHHHHHHHHhhC
Q 027449           86 RFSNGVIPSDLIAQEFGIKELLPAYLDPNLKPQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAG  165 (223)
Q Consensus        86 RfSnG~~~~D~la~~lgl~~~~ppyl~~~~~~~~~~~G~NFA~gGA~~~~~~~~~~~~~sl~~Qv~~F~~~~~~l~~~~g  165 (223)
                      |+..+..|+..|++.|+-. + +.           ..=+|.+++|.++.....    ......-++.+.+....      
T Consensus        20 ~~~~~~~w~~~L~~~l~~~-~-~~-----------~~viN~Gv~G~tt~~~~~----~~~~~~~l~~l~~~l~~------   76 (208)
T cd01839          20 RYPFEDRWPGVLEKALGAN-G-EN-----------VRVIEDGLPGRTTVLDDP----FFPGRNGLTYLPQALES------   76 (208)
T ss_pred             cCCcCCCCHHHHHHHHccC-C-CC-----------eEEEecCcCCcceeccCc----cccCcchHHHHHHHHHh------
Confidence            5556778999999998643 2 11           123799999987532111    01111122222222110      


Q ss_pred             hHHHhhhhcCcEEEEEeccchhhh
Q 027449          166 EEATANILSKGLFMVVSGSDDIAN  189 (223)
Q Consensus       166 ~~~~~~~~~~sLf~i~iG~NDy~~  189 (223)
                            ...-.+++|++|.||+..
T Consensus        77 ------~~~pd~vii~lGtND~~~   94 (208)
T cd01839          77 ------HSPLDLVIIMLGTNDLKS   94 (208)
T ss_pred             ------CCCCCEEEEecccccccc
Confidence                  124478999999999864


No 9  
>cd01823 SEST_like SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
Probab=96.05  E-value=0.015  Score=49.55  Aligned_cols=61  Identities=20%  Similarity=0.157  Sum_probs=36.3

Q ss_pred             EEEEeCCchhhcCCCCCcccccccCCCCCCCCCCCCCCcccCCCCChhHHHHHHHhCCCCCCCCcCCCCCCCCCCCCcce
Q 027449           46 AVFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGIKELLPAYLDPNLKPQDLVTGVS  125 (223)
Q Consensus        46 ~lfvFGDSlsDtGn~~~~~~~~~~~~~PyG~~~~~~~ptGRfSnG~~~~D~la~~lgl~~~~ppyl~~~~~~~~~~~G~N  125 (223)
                      .+.++|||++--=..           .++... .. .-..|.  .+.|++.+++.|+..    +           ..-.|
T Consensus         2 ~~v~iGDS~~~G~g~-----------~~~~~~-~~-~~c~rs--~~~y~~~la~~l~~~----~-----------~~~~n   51 (259)
T cd01823           2 RYVALGDSYAAGPGA-----------GPLDDG-PD-DGCRRS--SNSYPTLLARALGDE----T-----------LSFTD   51 (259)
T ss_pred             CEEEecchhhcCCCC-----------CcccCC-CC-CCCccC--CccHHHHHHHHcCCC----C-----------ceeee
Confidence            478899998753221           111100 11 123444  467899999998853    0           12379


Q ss_pred             eeeecCCcCCC
Q 027449          126 FASGGAGYDPL  136 (223)
Q Consensus       126 FA~gGA~~~~~  136 (223)
                      +|.+|+++.+.
T Consensus        52 ~a~sGa~~~~~   62 (259)
T cd01823          52 VACSGATTTDG   62 (259)
T ss_pred             eeecCcccccc
Confidence            99999997554


No 10 
>cd01832 SGNH_hydrolase_like_1 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
Probab=95.91  E-value=0.066  Score=42.88  Aligned_cols=52  Identities=19%  Similarity=0.159  Sum_probs=32.5

Q ss_pred             EEEEeCCchhhcCCCCCcccccccCCCCCCCCCCCCCCcccCCCCChhHHHHHHHhCCCCCCCCcCCCCCCCCCCCCcce
Q 027449           46 AVFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGIKELLPAYLDPNLKPQDLVTGVS  125 (223)
Q Consensus        46 ~lfvFGDSlsDtGn~~~~~~~~~~~~~PyG~~~~~~~ptGRfSnG~~~~D~la~~lgl~~~~ppyl~~~~~~~~~~~G~N  125 (223)
                      +|.+||||+++ |...                      ++....+..|++.+++.+.-+ . +.           ..-.|
T Consensus         1 ~i~~~GDSit~-G~~~----------------------~~~~~~~~~~~~~l~~~l~~~-~-~~-----------~~~~N   44 (185)
T cd01832           1 RYVALGDSITE-GVGD----------------------PVPDGGYRGWADRLAAALAAA-D-PG-----------IEYAN   44 (185)
T ss_pred             CeeEecchhhc-ccCC----------------------CCCCCccccHHHHHHHHhccc-C-CC-----------ceEee
Confidence            37889999988 3321                      001124567899999998542 1 11           12369


Q ss_pred             eeeecCCc
Q 027449          126 FASGGAGY  133 (223)
Q Consensus       126 FA~gGA~~  133 (223)
                      .+.+|++.
T Consensus        45 ~g~~G~~~   52 (185)
T cd01832          45 LAVRGRRT   52 (185)
T ss_pred             ccCCcchH
Confidence            99999874


No 11 
>cd01824 Phospholipase_B_like Phospholipase-B_like. This subgroup of the SGNH-family of lipolytic enzymes may have both esterase and phospholipase-A/lysophospholipase activity.  It's members may be involved in the conversion of phosphatidylcholine to fatty acids and glycerophosphocholine, perhaps in the context of dietary lipid uptake. Members may be membrane proteins. The tertiary fold of the SGNH-hydrolases is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; Its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases.
Probab=94.58  E-value=0.59  Score=41.21  Aligned_cols=126  Identities=14%  Similarity=0.241  Sum_probs=60.6

Q ss_pred             CCCCCEEEEeCCchhhcCCCCCcccccccCCCCC-CCCCCCCCCcccCCCCChhHHHHHHHhCCCCCCCCcCCCCCCCCC
Q 027449           41 NESVPAVFVFGDSIADPGNNNNIKTIIKCNFPPY-GRDFKGKIATGRFSNGVIPSDLIAQEFGIKELLPAYLDPNLKPQD  119 (223)
Q Consensus        41 ~~~~~~lfvFGDSlsDtGn~~~~~~~~~~~~~Py-G~~~~~~~ptGRfSnG~~~~D~la~~lgl~~~~ppyl~~~~~~~~  119 (223)
                      +..++-|-.+|||++= ||..-.....-. ...| |..|..+ -.+...+=.+++.+|-+. + | -+.-|.........
T Consensus         7 p~DI~viaA~GDSlta-g~ga~~~~~~~~-~~e~rG~s~~~G-g~~~~~~~~Tlpnil~~f-n-p-~l~G~s~~~~~~~~   80 (288)
T cd01824           7 PGDIKVIAALGDSLTA-GNGAGSANNLDL-LTEYRGLSWSIG-GDSTLRGLTTLPNILREF-N-P-SLYGYSVGTGDETL   80 (288)
T ss_pred             cccCeEEeeccccccc-cCCCCCCCcccc-ccccCCceEecC-CcccccccccHHHHHHHh-C-C-CcccccCCCCCCCC
Confidence            4578899999999974 443210000000 0011 3334211 011222335667766543 2 1 11112111111112


Q ss_pred             CCCcceeeeecCCcCCCCCccccCCCHHHHHHHHHHHHHHHHHhhChHHHhhhhcC-cEEEEEeccchhhh
Q 027449          120 LVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSK-GLFMVVSGSDDIAN  189 (223)
Q Consensus       120 ~~~G~NFA~gGA~~~~~~~~~~~~~sl~~Qv~~F~~~~~~l~~~~g~~~~~~~~~~-sLf~i~iG~NDy~~  189 (223)
                      -..+.|.|+.|+++.          .|..|++...+..++   .    ....+-.+ .|..|.||+||...
T Consensus        81 ~~~~~N~av~Ga~s~----------dL~~qa~~lv~r~~~---~----~~i~~~~dwklVtI~IG~ND~c~  134 (288)
T cd01824          81 PDSGFNVAEPGAKSE----------DLPQQARLLVRRMKK---D----PRVDFKNDWKLITIFIGGNDLCS  134 (288)
T ss_pred             cccceeecccCcchh----------hHHHHHHHHHHHHhh---c----cccccccCCcEEEEEecchhHhh
Confidence            235789999998853          467787755443221   0    00111122 37888999999975


No 12 
>cd01827 sialate_O-acetylesterase_like1 sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=94.57  E-value=0.21  Score=40.10  Aligned_cols=14  Identities=14%  Similarity=0.437  Sum_probs=12.0

Q ss_pred             CcEEEEEeccchhh
Q 027449          175 KGLFMVVSGSDDIA  188 (223)
Q Consensus       175 ~sLf~i~iG~NDy~  188 (223)
                      -.+.+|.+|.||..
T Consensus        68 pd~Vii~~G~ND~~   81 (188)
T cd01827          68 PNIVIIKLGTNDAK   81 (188)
T ss_pred             CCEEEEEcccCCCC
Confidence            36899999999975


No 13 
>cd01844 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=94.45  E-value=0.11  Score=41.64  Aligned_cols=25  Identities=12%  Similarity=0.339  Sum_probs=18.7

Q ss_pred             ChhHHHHHHHhCCCCCCCCcCCCCCCCCCCCCcceeeeecCCc
Q 027449           91 VIPSDLIAQEFGIKELLPAYLDPNLKPQDLVTGVSFASGGAGY  133 (223)
Q Consensus        91 ~~~~D~la~~lgl~~~~ppyl~~~~~~~~~~~G~NFA~gGA~~  133 (223)
                      ..|+..+++.+++.                  -.|.+++|++.
T Consensus        20 ~~~~~~~~~~~~~~------------------v~N~g~~G~~~   44 (177)
T cd01844          20 MAWTAILARRLGLE------------------VINLGFSGNAR   44 (177)
T ss_pred             CcHHHHHHHHhCCC------------------eEEeeeccccc
Confidence            46788888887754                  26999999763


No 14 
>cd04501 SGNH_hydrolase_like_4 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=94.14  E-value=0.31  Score=38.99  Aligned_cols=14  Identities=21%  Similarity=0.657  Sum_probs=11.4

Q ss_pred             CcEEEEEeccchhh
Q 027449          175 KGLFMVVSGSDDIA  188 (223)
Q Consensus       175 ~sLf~i~iG~NDy~  188 (223)
                      -.+.+|.+|.||..
T Consensus        60 ~d~v~i~~G~ND~~   73 (183)
T cd04501          60 PAVVIIMGGTNDII   73 (183)
T ss_pred             CCEEEEEeccCccc
Confidence            36788899999985


No 15 
>cd01830 XynE_like SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=94.06  E-value=0.43  Score=39.18  Aligned_cols=14  Identities=21%  Similarity=0.527  Sum_probs=11.5

Q ss_pred             cEEEEEeccchhhh
Q 027449          176 GLFMVVSGSDDIAN  189 (223)
Q Consensus       176 sLf~i~iG~NDy~~  189 (223)
                      .+.+|.+|.||...
T Consensus        76 ~~vii~~G~ND~~~   89 (204)
T cd01830          76 RTVIILEGVNDIGA   89 (204)
T ss_pred             CEEEEecccccccc
Confidence            47888999999864


No 16 
>cd01825 SGNH_hydrolase_peri1 SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=93.71  E-value=0.085  Score=42.24  Aligned_cols=13  Identities=15%  Similarity=0.399  Sum_probs=10.4

Q ss_pred             cEEEEEeccchhh
Q 027449          176 GLFMVVSGSDDIA  188 (223)
Q Consensus       176 sLf~i~iG~NDy~  188 (223)
                      .+++|.+|.||..
T Consensus        58 d~Vii~~G~ND~~   70 (189)
T cd01825          58 DLVILSYGTNEAF   70 (189)
T ss_pred             CEEEEECCCcccc
Confidence            5788899999964


No 17 
>cd01831 Endoglucanase_E_like Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
Probab=93.42  E-value=0.59  Score=37.09  Aligned_cols=45  Identities=20%  Similarity=0.313  Sum_probs=25.1

Q ss_pred             EEEEeCCchhhcCCCCCcccccccCCCCCCCCCCCCCCcccCCCCChhHHHHHHHhCCC
Q 027449           46 AVFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGIK  104 (223)
Q Consensus        46 ~lfvFGDSlsDtGn~~~~~~~~~~~~~PyG~~~~~~~ptGRfSnG~~~~D~la~~lgl~  104 (223)
                      +|.++|||++. |-....  ..++..+|           .+..-...|+..+++.++..
T Consensus         1 ~i~~iGDSit~-G~~~~~--~~~~~~~~-----------~~~~~~~~~~~~la~~l~~~   45 (169)
T cd01831           1 KIEFIGDSITC-GYGVTG--KSRCDFSA-----------ATEDPSLSYAALLARALNAE   45 (169)
T ss_pred             CEEEEeccccc-cCccCC--CCCCCCcc-----------cccchhhhHHHHHHHHhCCc
Confidence            36889999987 332110  00011111           12223467889999998864


No 18 
>cd01822 Lysophospholipase_L1_like Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.
Probab=93.28  E-value=0.65  Score=36.61  Aligned_cols=14  Identities=21%  Similarity=0.290  Sum_probs=11.4

Q ss_pred             CcEEEEEeccchhh
Q 027449          175 KGLFMVVSGSDDIA  188 (223)
Q Consensus       175 ~sLf~i~iG~NDy~  188 (223)
                      -.+++|.+|.||..
T Consensus        65 pd~v~i~~G~ND~~   78 (177)
T cd01822          65 PDLVILELGGNDGL   78 (177)
T ss_pred             CCEEEEeccCcccc
Confidence            35889999999964


No 19 
>PF13472 Lipase_GDSL_2:  GDSL-like Lipase/Acylhydrolase family; PDB: 1ES9_A 1WAB_A 3DT9_A 1BWQ_A 1FXW_A 3DT6_A 1BWR_A 3DT8_A 1BWP_A 2WAA_A ....
Probab=93.22  E-value=1.1  Score=34.56  Aligned_cols=16  Identities=25%  Similarity=0.528  Sum_probs=10.8

Q ss_pred             cCcEEEEEeccchhhh
Q 027449          174 SKGLFMVVSGSDDIAN  189 (223)
Q Consensus       174 ~~sLf~i~iG~NDy~~  189 (223)
                      .-.+++|.+|+||...
T Consensus        61 ~~d~vvi~~G~ND~~~   76 (179)
T PF13472_consen   61 KPDLVVISFGTNDVLN   76 (179)
T ss_dssp             TCSEEEEE--HHHHCT
T ss_pred             CCCEEEEEcccccccc
Confidence            3358899999999864


No 20 
>KOG3670 consensus Phospholipase [Lipid transport and metabolism]
Probab=93.20  E-value=0.5  Score=43.32  Aligned_cols=19  Identities=26%  Similarity=0.504  Sum_probs=14.9

Q ss_pred             CCCCEEEEeCCchhhcCCCC
Q 027449           42 ESVPAVFVFGDSIADPGNNN   61 (223)
Q Consensus        42 ~~~~~lfvFGDSlsDtGn~~   61 (223)
                      ..+..|=.+|||++ +|+..
T Consensus        73 ~dI~vIgAmGDSLt-~G~ga   91 (397)
T KOG3670|consen   73 EDIKVIGAMGDSLT-NGAGA   91 (397)
T ss_pred             ccceeeeeccchhh-ccCCC
Confidence            35678888999999 77764


No 21 
>PRK10528 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1; Provisional
Probab=92.69  E-value=0.91  Score=37.03  Aligned_cols=14  Identities=21%  Similarity=0.197  Sum_probs=11.5

Q ss_pred             CcEEEEEeccchhh
Q 027449          175 KGLFMVVSGSDDIA  188 (223)
Q Consensus       175 ~sLf~i~iG~NDy~  188 (223)
                      -.+.+|.+|.||..
T Consensus        72 pd~Vii~~GtND~~   85 (191)
T PRK10528         72 PRWVLVELGGNDGL   85 (191)
T ss_pred             CCEEEEEeccCcCc
Confidence            36889999999963


No 22 
>cd01836 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=92.04  E-value=0.93  Score=36.41  Aligned_cols=15  Identities=13%  Similarity=0.317  Sum_probs=12.4

Q ss_pred             cCcEEEEEeccchhh
Q 027449          174 SKGLFMVVSGSDDIA  188 (223)
Q Consensus       174 ~~sLf~i~iG~NDy~  188 (223)
                      .-.+.+|.+|+||..
T Consensus        67 ~pd~Vii~~G~ND~~   81 (191)
T cd01836          67 RFDVAVISIGVNDVT   81 (191)
T ss_pred             CCCEEEEEecccCcC
Confidence            346899999999985


No 23 
>cd01835 SGNH_hydrolase_like_3 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=90.79  E-value=2.3  Score=34.24  Aligned_cols=16  Identities=19%  Similarity=0.283  Sum_probs=13.3

Q ss_pred             cCcEEEEEeccchhhh
Q 027449          174 SKGLFMVVSGSDDIAN  189 (223)
Q Consensus       174 ~~sLf~i~iG~NDy~~  189 (223)
                      +-.+.+|.+|.||...
T Consensus        69 ~pd~V~i~~G~ND~~~   84 (193)
T cd01835          69 VPNRLVLSVGLNDTAR   84 (193)
T ss_pred             CCCEEEEEecCccccc
Confidence            4478999999999864


No 24 
>cd01821 Rhamnogalacturan_acetylesterase_like Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
Probab=90.37  E-value=3.1  Score=33.66  Aligned_cols=15  Identities=13%  Similarity=0.242  Sum_probs=12.5

Q ss_pred             CcEEEEEeccchhhh
Q 027449          175 KGLFMVVSGSDDIAN  189 (223)
Q Consensus       175 ~sLf~i~iG~NDy~~  189 (223)
                      -.+++|.+|.||...
T Consensus        66 pdlVii~~G~ND~~~   80 (198)
T cd01821          66 GDYVLIQFGHNDQKP   80 (198)
T ss_pred             CCEEEEECCCCCCCC
Confidence            378999999999753


No 25 
>cd01838 Isoamyl_acetate_hydrolase_like Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash.  The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases
Probab=89.81  E-value=0.8  Score=36.60  Aligned_cols=16  Identities=25%  Similarity=0.351  Sum_probs=13.1

Q ss_pred             cCcEEEEEeccchhhh
Q 027449          174 SKGLFMVVSGSDDIAN  189 (223)
Q Consensus       174 ~~sLf~i~iG~NDy~~  189 (223)
                      +-.+++|++|.||...
T Consensus        63 ~pd~vii~~G~ND~~~   78 (199)
T cd01838          63 QPDLVTIFFGANDAAL   78 (199)
T ss_pred             CceEEEEEecCccccC
Confidence            4468999999999863


No 26 
>COG2755 TesA Lysophospholipase L1 and related esterases [Amino acid transport and metabolism]
Probab=81.89  E-value=6.6  Score=32.08  Aligned_cols=14  Identities=29%  Similarity=0.646  Sum_probs=12.4

Q ss_pred             CcEEEEEeccchhh
Q 027449          175 KGLFMVVSGSDDIA  188 (223)
Q Consensus       175 ~sLf~i~iG~NDy~  188 (223)
                      -.+.+|.+|.||..
T Consensus        78 ~d~v~i~lG~ND~~   91 (216)
T COG2755          78 PDLVIIMLGGNDIG   91 (216)
T ss_pred             CCEEEEEeeccccc
Confidence            57899999999985


No 27 
>PF14606 Lipase_GDSL_3:  GDSL-like Lipase/Acylhydrolase family; PDB: 3SKV_B.
Probab=77.72  E-value=16  Score=30.12  Aligned_cols=45  Identities=18%  Similarity=0.414  Sum_probs=28.2

Q ss_pred             CEEEEeCCchhhcCCCCCcccccccCCCCCCCCCCCCCCcccCCCCChhHHHHHHHhCCCCCCCCcCCCCCCCCCCCCcc
Q 027449           45 PAVFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGIKELLPAYLDPNLKPQDLVTGV  124 (223)
Q Consensus        45 ~~lfvFGDSlsDtGn~~~~~~~~~~~~~PyG~~~~~~~ptGRfSnG~~~~D~la~~lgl~~~~ppyl~~~~~~~~~~~G~  124 (223)
                      +.+++.|+|++..+...                          +-|..|+-.++..+|++ +                 +
T Consensus         2 k~~v~YGsSItqG~~As--------------------------rpg~~~~~~~aR~l~~~-~-----------------i   37 (178)
T PF14606_consen    2 KRWVAYGSSITQGACAS--------------------------RPGMAYPAILARRLGLD-V-----------------I   37 (178)
T ss_dssp             -EEEEEE-TT-TTTT-S--------------------------SGGGSHHHHHHHHHT-E-E-----------------E
T ss_pred             CeEEEECChhhcCCCCC--------------------------CCcccHHHHHHHHcCCC-e-----------------E
Confidence            35778888877765421                          13456888999999987 2                 6


Q ss_pred             eeeeecCCc
Q 027449          125 SFASGGAGY  133 (223)
Q Consensus       125 NFA~gGA~~  133 (223)
                      |++.+|++.
T Consensus        38 NLGfsG~~~   46 (178)
T PF14606_consen   38 NLGFSGNGK   46 (178)
T ss_dssp             EEE-TCCCS
T ss_pred             eeeecCccc
Confidence            999999774


No 28 
>cd04506 SGNH_hydrolase_YpmR_like Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
Probab=54.72  E-value=19  Score=29.07  Aligned_cols=18  Identities=11%  Similarity=0.372  Sum_probs=14.0

Q ss_pred             cCcEEEEEeccchhhhhh
Q 027449          174 SKGLFMVVSGSDDIANTY  191 (223)
Q Consensus       174 ~~sLf~i~iG~NDy~~~~  191 (223)
                      .-.+.+|.+|+||+....
T Consensus        68 ~~d~V~i~~G~ND~~~~~   85 (204)
T cd04506          68 KADVITITIGGNDLMQVL   85 (204)
T ss_pred             cCCEEEEEecchhHHHHH
Confidence            346889999999997543


No 29 
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=52.92  E-value=14  Score=20.19  Aligned_cols=20  Identities=25%  Similarity=0.657  Sum_probs=14.9

Q ss_pred             CchhHHHHHHHHHHHhhccc
Q 027449           14 PSFSIIIFFFLLFIYFSENG   33 (223)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~   33 (223)
                      ..|+.++-+|++|++..+++
T Consensus         4 ~~FalivVLFILLiIvG~s~   23 (24)
T PF09680_consen    4 SGFALIVVLFILLIIVGASC   23 (24)
T ss_pred             ccchhHHHHHHHHHHhccee
Confidence            35778888888888876653


No 30 
>cd01834 SGNH_hydrolase_like_2 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=50.37  E-value=23  Score=27.72  Aligned_cols=16  Identities=13%  Similarity=0.183  Sum_probs=13.3

Q ss_pred             CcEEEEEeccchhhhh
Q 027449          175 KGLFMVVSGSDDIANT  190 (223)
Q Consensus       175 ~sLf~i~iG~NDy~~~  190 (223)
                      -.+++|++|.||....
T Consensus        62 ~d~v~l~~G~ND~~~~   77 (191)
T cd01834          62 PDVVSIMFGINDSFRG   77 (191)
T ss_pred             CCEEEEEeecchHhhc
Confidence            3689999999999753


No 31 
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=33.48  E-value=75  Score=25.25  Aligned_cols=14  Identities=21%  Similarity=0.458  Sum_probs=11.6

Q ss_pred             cEEEEEeccchhhh
Q 027449          176 GLFMVVSGSDDIAN  189 (223)
Q Consensus       176 sLf~i~iG~NDy~~  189 (223)
                      .+.+|.+|+||...
T Consensus        61 d~vii~~G~ND~~~   74 (200)
T cd01829          61 DVVVVFLGANDRQD   74 (200)
T ss_pred             CEEEEEecCCCCcc
Confidence            67888999999853


No 32 
>TIGR01732 tiny_TM_bacill conserved hypothetical tiny transmembrane protein. This model represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=33.26  E-value=51  Score=18.41  Aligned_cols=19  Identities=21%  Similarity=0.655  Sum_probs=13.8

Q ss_pred             CchhHHHHHHHHHHHhhcc
Q 027449           14 PSFSIIIFFFLLFIYFSEN   32 (223)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~   32 (223)
                      ..+..++-+|++|++..++
T Consensus         6 ~gf~livVLFILLIIiga~   24 (26)
T TIGR01732         6 GGFALIVVLFILLVIVGAA   24 (26)
T ss_pred             cchHHHHHHHHHHHHhhee
Confidence            3577788888888886654


No 33 
>PF03996 Hema_esterase:  Hemagglutinin esterase;  InterPro: IPR007142 Haemagglutinin-esterase fusion glycoprotein (HEF) is a multi-functional protein embedded in the viral envelope of several viruses, including influenza C virus, coronaviruses and toroviruses [, ]. HEF is required for infectivity, and functions to recognise the host cell surface receptor, to fuse the viral and host cell membranes, and to destroy the receptor upon host cell infection. The haemagglutinin region of HEF is responsible for receptor recognition and membrane fusion, and bears a strong resemblance to the sialic acid-binding haemagglutinin found in influenza A and B viruses, except that it binds 9-O-acetylsialic acid. The esterase region of HEF is responsible for the destruction of the receptor, an action that is carried out by neuraminidase in influenza A and B viruses. The esterase domain is similar in structure to Streptomyces scabies esterase, and to acetylhydrolase, thioesterase I and rhamnogalacturonan acetylesterase. The haemagglutinin-esterase glycoprotein HEF must be cleaved by the host's trypsin-like proteases to produce two peptides (HEF1 and HEF2) in order for the virus to be infectious. Once HEF is cleaved, the newly exposed N-terminal of the HEF2 peptide then acts to fuse the viral envelope to the cellular membrane of the host cell, which allows the virus to infect the host cell. The haemagglutinin-esterase glycoprotein is a trimer, where each monomer is composed of three domains: an elongated stem active in membrane fusion, an esterase domain, and a receptor-binding domain, where the stem and receptor-binding domains together resemble influenza A virus haemagglutinin. Two of these domains are composed of non-contiguous sequence: the receptor-binding haemagglutinin domain is inserted into a surface loop of the esterase domain, and the esterase domain is inserted into a surface loop of the haemagglutinin stem.  This entry represents the core of the haemagglutinin-esterase glycoprotein, including the haemagglutinin receptor-binding domain and the esterase domain. More information about haemagglutinin proteins can be found at Protein of the Month: Bird Flu, Haemagglutinin [].; GO: 0016788 hydrolase activity, acting on ester bonds, 0046789 host cell surface receptor binding, 0019064 viral envelope fusion with host membrane, 0019031 viral envelope; PDB: 3CL5_A 3CL4_A 3I26_D 3I27_C 1FLC_E 3I1L_C 3I1K_C.
Probab=32.05  E-value=30  Score=29.65  Aligned_cols=17  Identities=41%  Similarity=0.645  Sum_probs=13.6

Q ss_pred             CEEEEeCCchhhc---CCCC
Q 027449           45 PAVFVFGDSIADP---GNNN   61 (223)
Q Consensus        45 ~~lfvFGDSlsDt---Gn~~   61 (223)
                      ...|-||||-||+   .|..
T Consensus        45 ~dW~lFGDSRSDC~~~~N~~   64 (258)
T PF03996_consen   45 SDWFLFGDSRSDCNHINNSQ   64 (258)
T ss_dssp             SSEEEEESGGG-TGGGTSTT
T ss_pred             cceeEecCccccccccCCCC
Confidence            4789999999999   7764


No 34 
>cd04502 SGNH_hydrolase_like_7 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=31.65  E-value=46  Score=25.92  Aligned_cols=14  Identities=21%  Similarity=0.451  Sum_probs=11.7

Q ss_pred             CcEEEEEeccchhh
Q 027449          175 KGLFMVVSGSDDIA  188 (223)
Q Consensus       175 ~sLf~i~iG~NDy~  188 (223)
                      -.+.+|.+|.||..
T Consensus        51 p~~vvi~~G~ND~~   64 (171)
T cd04502          51 PRRVVLYAGDNDLA   64 (171)
T ss_pred             CCEEEEEEecCccc
Confidence            35899999999974


No 35 
>cd00229 SGNH_hydrolase SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=30.55  E-value=61  Score=24.07  Aligned_cols=17  Identities=18%  Similarity=0.391  Sum_probs=13.9

Q ss_pred             hcCcEEEEEeccchhhh
Q 027449          173 LSKGLFMVVSGSDDIAN  189 (223)
Q Consensus       173 ~~~sLf~i~iG~NDy~~  189 (223)
                      .+-.++++.+|+||+..
T Consensus        64 ~~~d~vil~~G~ND~~~   80 (187)
T cd00229          64 DKPDLVIIELGTNDLGR   80 (187)
T ss_pred             CCCCEEEEEeccccccc
Confidence            35678999999999864


No 36 
>cd01833 XynB_like SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=28.55  E-value=56  Score=24.92  Aligned_cols=16  Identities=13%  Similarity=0.353  Sum_probs=13.0

Q ss_pred             cCcEEEEEeccchhhh
Q 027449          174 SKGLFMVVSGSDDIAN  189 (223)
Q Consensus       174 ~~sLf~i~iG~NDy~~  189 (223)
                      +-.+.+|.+|+||...
T Consensus        40 ~pd~vvi~~G~ND~~~   55 (157)
T cd01833          40 KPDVVLLHLGTNDLVL   55 (157)
T ss_pred             CCCEEEEeccCccccc
Confidence            4478999999999854


No 37 
>cd01820 PAF_acetylesterase_like PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases. Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues.  In addition,  PAF and PAF-AH are associated with neural migration and mammalian reproduction.
Probab=26.66  E-value=56  Score=26.68  Aligned_cols=14  Identities=14%  Similarity=0.491  Sum_probs=11.9

Q ss_pred             CcEEEEEeccchhh
Q 027449          175 KGLFMVVSGSDDIA  188 (223)
Q Consensus       175 ~sLf~i~iG~NDy~  188 (223)
                      -.+++|.+|+||..
T Consensus        90 pd~VvI~~G~ND~~  103 (214)
T cd01820          90 PKVVVLLIGTNNIG  103 (214)
T ss_pred             CCEEEEEecccccC
Confidence            46889999999974


No 38 
>PF02896 PEP-utilizers_C:  PEP-utilising enzyme, TIM barrel domain;  InterPro: IPR000121 A number of enzymes that catalyze the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) via a phospho-histidine intermediate have been shown to be structurally related [, , , ]. All these enzymes share the same catalytic mechanism: they bind PEP and transfer the phosphoryl group from it to a histidine residue. The sequence around that residue is highly conserved. This domain is often found associated with the pyruvate phosphate dikinase, PEP/pyruvate-binding domain (IPR002192 from INTERPRO) at its N terminus and the PEP-utilizing enzyme mobile domain.; GO: 0016772 transferase activity, transferring phosphorus-containing groups, 0016310 phosphorylation; PDB: 2HRO_A 2OLS_A 2DIK_A 2R82_A 1JDE_A 1DIK_A 1GGO_A 1KBL_A 1KC7_A 2BG5_B ....
Probab=26.02  E-value=76  Score=28.15  Aligned_cols=47  Identities=11%  Similarity=0.105  Sum_probs=24.0

Q ss_pred             cCcEEEEEeccchhhhhhccCCCCC--CccChhhHHHHHHHHHHHHHHH
Q 027449          174 SKGLFMVVSGSDDIANTYLSTPFRR--GQYDINSYTDLTASSALSFLQV  220 (223)
Q Consensus       174 ~~sLf~i~iG~NDy~~~~~~~~~~~--~~~~~~~~v~~vv~~i~~~i~~  220 (223)
                      .+-+=+++||+||..+..+.-....  ..+--+.+-|.|+..++..++.
T Consensus       195 ~~~~DF~SIGtNDLtQy~la~DR~n~~v~~~~d~~~Pavl~li~~vi~~  243 (293)
T PF02896_consen  195 AKEVDFFSIGTNDLTQYTLAADRDNARVAYLYDPLHPAVLRLIKQVIDA  243 (293)
T ss_dssp             HTTSSEEEEEHHHHHHHHHTS-TTCCTCGGGS-TTSHHHHHHHHHHHHH
T ss_pred             HHHCCEEEEChhHHHHHHhhcCCCCcchhhhcCcchHHHHHHHHHHHHH
Confidence            3346688999999987444211101  0001123445666666555543


No 39 
>PF08282 Hydrolase_3:  haloacid dehalogenase-like hydrolase;  InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification []. This HAD domain is found in several distinct enzymes including:  Phospholipid-transporting ATPase 1 (3.6.3.1 from EC), a putative lipid-flipping enzyme involved in cold tolerance in Arabidopsis [] 3-deoxy-D-manno-octulosonate (KDO) 8-phosphate phosphatase (3.1.3.45 from EC), which catalyses the final step in the biosynthesis of KDO - a component of lipopolysaccharide in Gram-negative bacteria [] Mannosyl-3-phosphoglycerate phosphatase (3.1.3.70 from EC), which hydrolyzes mannosyl-3-phosphoglycerate to form the osmolyte mannosylglycerate [] Phosphoglycolate phopshatase (3.1.3.18 from EC), which catalyses the dephosphorylation of 2-phosphoglycolate []  ; PDB: 2B30_B 3R4C_A 1XVI_B 3IJ5_B 3MMZ_C 3L7Y_A 1XPJ_C 1RLT_B 1RLM_B 2HF2_A ....
Probab=24.03  E-value=40  Score=27.36  Aligned_cols=14  Identities=36%  Similarity=0.529  Sum_probs=12.0

Q ss_pred             CEEEEeCCchhhcC
Q 027449           45 PAVFVFGDSIADPG   58 (223)
Q Consensus        45 ~~lfvFGDSlsDtG   58 (223)
                      ..+++||||.+|.-
T Consensus       203 ~~~~~~GD~~ND~~  216 (254)
T PF08282_consen  203 EDIIAFGDSENDIE  216 (254)
T ss_dssp             GGEEEEESSGGGHH
T ss_pred             ceeEEeecccccHh
Confidence            57899999999963


No 40 
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed
Probab=21.27  E-value=58  Score=27.84  Aligned_cols=17  Identities=24%  Similarity=0.259  Sum_probs=13.6

Q ss_pred             CCEEEEeCCchhhcCCC
Q 027449           44 VPAVFVFGDSIADPGNN   60 (223)
Q Consensus        44 ~~~lfvFGDSlsDtGn~   60 (223)
                      ...+++||||..|.-=.
T Consensus       206 ~~~viafGDs~NDi~Ml  222 (271)
T PRK03669        206 RPTTLGLGDGPNDAPLL  222 (271)
T ss_pred             CceEEEEcCCHHHHHHH
Confidence            46889999999997543


No 41 
>KOG3035 consensus Isoamyl acetate-hydrolyzing esterase [Lipid transport and metabolism]
Probab=21.18  E-value=63  Score=27.72  Aligned_cols=20  Identities=30%  Similarity=0.506  Sum_probs=16.1

Q ss_pred             CCCCEEEEeCCchhhcCCCC
Q 027449           42 ESVPAVFVFGDSIADPGNNN   61 (223)
Q Consensus        42 ~~~~~lfvFGDSlsDtGn~~   61 (223)
                      +-+++|+.||||++.-+...
T Consensus         4 ~~rp~i~LFGdSItq~sF~~   23 (245)
T KOG3035|consen    4 PMRPRIVLFGDSITQFSFTD   23 (245)
T ss_pred             cccccEEEecchhhhhcccC
Confidence            35789999999998877653


No 42 
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family. This small group of proteins is a member of the IIB subfamily (TIGR01484) of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. Several members of this family from thermophiles (and from Dehalococcoides ethenogenes) are now known to act as mannosyl-3-phosphoglycerate (MPG) phosphatase. In these cases, the enzyme acts after MPG synthase to make the compatible solute mannosylglycerate. We propose that other mesophilic members of this family do not act as mannosyl-3-phosphoglycerate phosphatase. A member of this family is found in Escherichia coli, which appears to lack MPG synthase. Mannosylglycerate is imported in E. coli by phosphoenolpyruvate-dependent transporter (PubMed:14645248), but it appears the phosphorylation is not on the glycerate moiety, that the phosphorylated import is degraded by an alpha-mannosidase from an adjacent gene, and that E. coli would have no pathway to obta
Probab=20.24  E-value=57  Score=27.51  Aligned_cols=18  Identities=28%  Similarity=0.106  Sum_probs=14.7

Q ss_pred             CCEEEEeCCchhhcCCCC
Q 027449           44 VPAVFVFGDSIADPGNNN   61 (223)
Q Consensus        44 ~~~lfvFGDSlsDtGn~~   61 (223)
                      ...+++||||.+|..-..
T Consensus       194 ~~~~~a~GD~~ND~~Ml~  211 (256)
T TIGR01486       194 AIKVVGLGDSPNDLPLLE  211 (256)
T ss_pred             CceEEEEcCCHhhHHHHH
Confidence            467999999999986554


No 43 
>cd01841 NnaC_like NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.
Probab=20.04  E-value=1.8e+02  Score=22.45  Aligned_cols=13  Identities=23%  Similarity=0.496  Sum_probs=11.2

Q ss_pred             cEEEEEeccchhh
Q 027449          176 GLFMVVSGSDDIA  188 (223)
Q Consensus       176 sLf~i~iG~NDy~  188 (223)
                      .+.+|.+|.||..
T Consensus        53 d~v~i~~G~ND~~   65 (174)
T cd01841          53 SKVFLFLGTNDIG   65 (174)
T ss_pred             CEEEEEeccccCC
Confidence            6788899999974


Done!