Citrus Sinensis ID: 027475


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MSRRPVSSTRRLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGISSMFHLMKFSSDTWTEIHALMYTSLDLQ
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccEEccccccccHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccEEEEEEccccccccccccEEEEccccccccHHHHHcccHHHHHHccccEEEEEcccccccccccccccHHEEEEHHHcccccc
ccccccccccccccccccccHccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccccccccHHHHHHHHHHHHHHHcccHHHEEEccccccHHHHHHHccccccEcccccccHHcHHHHHHHHHHccEEEEEEEccccccccccccEEEEEcHHHHccHHHHHHHcHHHHEEccccEEEEEcccccccccccccccHHHHHHHHHHHcccc
msrrpvsstrrlvdtgsfpftgalqsksrsspllsVGLVLVGAFLLIGYafsgsgifggdkaavsriegdfsctSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKeeeteawgvepydiedaDARCKSLVHKGivrvadikfplpyraksfplVIVSDAldylspkylnktlpdlarvaSDGVLIFAGISSMFHLMKFSSDTWTEIHALMYTSLDLQ
msrrpvsstrrlvdtgsfpftgalqsksrsspLLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEeeteawgvepydiEDADARCKSLVHKGIVrvadikfplpyraKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGISSMFHLMKFSSDTWTEIHALMYTSLDLQ
MSRRPVSSTRRLVDTGSFPFTGALQSKSRsspllsvglvlvgaflligYAFSGSGIFGGDKAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGISSMFHLMKFSSDTWTEIHALMYTSLDLQ
********************************LLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGISSMFHLMKFSSDTWTEIHALMYTS****
*********************************LSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGISSMFHLMKFSSDTWTEIHALMYTSLD**
**********RLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGISSMFHLMKFSSDTWTEIHALMYTSLDLQ
*****************************SSPLLSVGLVLVGAFLLIGYAFSGS***GGDKAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGISSMFHLMKFSSDTWTEIHALMYTSLDLQ
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRRPVSSTRRLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGISSMFHLMKFSSDTWTEIHALMYTSLDLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query223 2.2.26 [Sep-21-2011]
Q9M2Y6261 Uncharacterized protein A yes no 0.869 0.743 0.8 3e-86
>sp|Q9M2Y6|Y3972_ARATH Uncharacterized protein At3g49720 OS=Arabidopsis thaliana GN=At3g49720 PE=1 SV=1 Back     alignment and function desciption
 Score =  317 bits (813), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 174/195 (89%), Gaps = 1/195 (0%)

Query: 1   MSRRPVSSTRRLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGD 60
           M+RR V STRR+ D GSFPF GAL SKSRSSPLLS+ LVLVGA LLIGYA+SG GIF   
Sbjct: 1   MARRQVGSTRRVGDGGSFPFAGALHSKSRSSPLLSICLVLVGACLLIGYAYSGPGIFKSI 60

Query: 61  KAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGV 120
           K  VS++ GD+SCT+E+QRAIP+LKKAYGD M KVLHVGPDTCSVVS+LLKEEETEAWGV
Sbjct: 61  KE-VSKVTGDYSCTAEVQRAIPVLKKAYGDGMRKVLHVGPDTCSVVSSLLKEEETEAWGV 119

Query: 121 EPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPD 180
           EPYDIEDAD+ CKS V KG+VRVADIKFPLPYRAKSF LVIVSDALDYLSPKYLNKT+P+
Sbjct: 120 EPYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSPKYLNKTVPE 179

Query: 181 LARVASDGVLIFAGI 195
           LARVASDGV++FAG+
Sbjct: 180 LARVASDGVVLFAGL 194





Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
359497262203 PREDICTED: uncharacterized protein At3g4 0.878 0.965 0.821 1e-89
297819624261 hypothetical protein ARALYDRAFT_485334 [ 0.869 0.743 0.8 2e-84
18408931261 uncharacterized protein [Arabidopsis tha 0.869 0.743 0.8 2e-84
297797611258 hypothetical protein ARALYDRAFT_332797 [ 0.852 0.736 0.773 1e-81
147801370256 hypothetical protein VITISV_037838 [Viti 0.847 0.738 0.779 2e-81
21593192258 unknown [Arabidopsis thaliana] 0.852 0.736 0.778 2e-81
18424995258 uncharacterized protein [Arabidopsis tha 0.852 0.736 0.778 3e-81
9758568219 unnamed protein product [Arabidopsis tha 0.852 0.867 0.778 7e-81
449449222258 PREDICTED: uncharacterized protein At3g4 0.968 0.837 0.685 1e-80
224105811262 predicted protein [Populus trichocarpa] 0.937 0.797 0.672 1e-79
>gi|359497262|ref|XP_002264014.2| PREDICTED: uncharacterized protein At3g49720-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 177/196 (90%)

Query: 1   MSRRPVSSTRRLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGD 60
           MSRR V+ +RR VD+GS PF GAL SKSRSSPLLS+GLVL+GAFLL+ Y++SGSG+FGGD
Sbjct: 1   MSRRQVNPSRRFVDSGSIPFAGALHSKSRSSPLLSIGLVLLGAFLLVAYSYSGSGLFGGD 60

Query: 61  KAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGV 120
           K A S++EGDFSCT E+QRAIPILKKAYGDSM KVLHVGPDTCSVVS LLKEEETEAWGV
Sbjct: 61  KEAFSKVEGDFSCTLEVQRAIPILKKAYGDSMRKVLHVGPDTCSVVSKLLKEEETEAWGV 120

Query: 121 EPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPD 180
           EPYDIEDAD  CKSLV K IVRVADIKFP+PYR KSF LVIVSDALDYLSPKYLNKTLPD
Sbjct: 121 EPYDIEDADGSCKSLVRKSIVRVADIKFPMPYRPKSFSLVIVSDALDYLSPKYLNKTLPD 180

Query: 181 LARVASDGVLIFAGIS 196
           LARV+SDG++IFAG S
Sbjct: 181 LARVSSDGLVIFAGNS 196




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297819624|ref|XP_002877695.1| hypothetical protein ARALYDRAFT_485334 [Arabidopsis lyrata subsp. lyrata] gi|297323533|gb|EFH53954.1| hypothetical protein ARALYDRAFT_485334 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18408931|ref|NP_566924.1| uncharacterized protein [Arabidopsis thaliana] gi|145332799|ref|NP_001078265.1| uncharacterized protein [Arabidopsis thaliana] gi|75183398|sp|Q9M2Y6.1|Y3972_ARATH RecName: Full=Uncharacterized protein At3g49720 gi|6723417|emb|CAB66910.1| hypothetical protein [Arabidopsis thaliana] gi|21593048|gb|AAM64997.1| unknown [Arabidopsis thaliana] gi|222424727|dbj|BAH20317.1| AT3G49720 [Arabidopsis thaliana] gi|332645059|gb|AEE78580.1| uncharacterized protein [Arabidopsis thaliana] gi|332645060|gb|AEE78581.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297797611|ref|XP_002866690.1| hypothetical protein ARALYDRAFT_332797 [Arabidopsis lyrata subsp. lyrata] gi|297312525|gb|EFH42949.1| hypothetical protein ARALYDRAFT_332797 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147801370|emb|CAN74732.1| hypothetical protein VITISV_037838 [Vitis vinifera] Back     alignment and taxonomy information
>gi|21593192|gb|AAM65141.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18424995|ref|NP_569020.1| uncharacterized protein [Arabidopsis thaliana] gi|110737950|dbj|BAF00912.1| hypothetical protein [Arabidopsis thaliana] gi|194579019|gb|ACF75543.1| At5g65810 [Arabidopsis thaliana] gi|332010727|gb|AED98110.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9758568|dbj|BAB09049.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449449222|ref|XP_004142364.1| PREDICTED: uncharacterized protein At3g49720-like isoform 1 [Cucumis sativus] gi|449449224|ref|XP_004142365.1| PREDICTED: uncharacterized protein At3g49720-like isoform 2 [Cucumis sativus] gi|449492714|ref|XP_004159079.1| PREDICTED: uncharacterized protein At3g49720-like isoform 1 [Cucumis sativus] gi|449492718|ref|XP_004159080.1| PREDICTED: uncharacterized protein At3g49720-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224105811|ref|XP_002313939.1| predicted protein [Populus trichocarpa] gi|118483865|gb|ABK93823.1| unknown [Populus trichocarpa] gi|222850347|gb|EEE87894.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
TAIR|locus:2097380261 AT3G49720 "AT3G49720" [Arabido 0.869 0.743 0.717 3.3e-70
TAIR|locus:2156208258 CGR3 "AT5G65810" [Arabidopsis 0.852 0.736 0.690 1.7e-66
TAIR|locus:2097380 AT3G49720 "AT3G49720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 711 (255.3 bits), Expect = 3.3e-70, P = 3.3e-70
 Identities = 140/195 (71%), Positives = 157/195 (80%)

Query:     1 MSRRPVSSTRRLVDTGSFPFTGALQSKSRXXXXXXXXXXXXXXXXXXXYAFSGSGIFGGD 60
             M+RR V STRR+ D GSFPF GAL SKSR                   YA+SG GIF   
Sbjct:     1 MARRQVGSTRRVGDGGSFPFAGALHSKSRSSPLLSICLVLVGACLLIGYAYSGPGIFKSI 60

Query:    61 KAAVSRIEGDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGV 120
             K  VS++ GD+SCT+E+QRAIP+LKKAYGD M KVLHVGPDTCSVVS+LLKEEETEAWGV
Sbjct:    61 KE-VSKVTGDYSCTAEVQRAIPVLKKAYGDGMRKVLHVGPDTCSVVSSLLKEEETEAWGV 119

Query:   121 EPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPD 180
             EPYDIEDAD+ CKS V KG+VRVADIKFPLPYRAKSF LVIVSDALDYLSPKYLNKT+P+
Sbjct:   120 EPYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSPKYLNKTVPE 179

Query:   181 LARVASDGVLIFAGI 195
             LARVASDGV++FAG+
Sbjct:   180 LARVASDGVVLFAGL 194




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2156208 CGR3 "AT5G65810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M2Y6Y3972_ARATHNo assigned EC number0.80.86990.7432yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.5__1326__AT3G49720.1
annotation not avaliable (261 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 223
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 98.63
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 97.4
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 97.3
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 96.82
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 96.22
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 95.91
PRK10258251 biotin biosynthesis protein BioC; Provisional 95.91
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 95.73
PLN02336 475 phosphoethanolamine N-methyltransferase 95.71
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 95.53
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 95.3
PRK05785226 hypothetical protein; Provisional 95.06
PRK06202232 hypothetical protein; Provisional 94.85
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 94.17
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 94.02
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 93.77
TIGR00740239 methyltransferase, putative. A simple BLAST search 93.22
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 93.18
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 92.39
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 91.41
PRK11207197 tellurite resistance protein TehB; Provisional 91.24
PLN02244340 tocopherol O-methyltransferase 90.75
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 90.75
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 90.75
PLN02233261 ubiquinone biosynthesis methyltransferase 90.06
PRK08317241 hypothetical protein; Provisional 89.95
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 89.93
PLN02585315 magnesium protoporphyrin IX methyltransferase 89.52
TIGR00452314 methyltransferase, putative. Known examples to dat 89.34
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 88.41
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 88.23
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 87.98
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 87.29
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 86.83
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 86.53
PRK12335287 tellurite resistance protein TehB; Provisional 86.45
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 86.22
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 85.3
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 84.8
PLN02490340 MPBQ/MSBQ methyltransferase 84.59
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 84.19
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 83.72
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 83.33
PLN02336475 phosphoethanolamine N-methyltransferase 82.75
PF11899380 DUF3419: Protein of unknown function (DUF3419); In 82.61
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 82.16
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 80.02
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
Probab=98.63  E-value=1.6e-08  Score=86.46  Aligned_cols=96  Identities=24%  Similarity=0.412  Sum_probs=85.6

Q ss_pred             cceeeeecCCcchhhhhccccccccccccccccccchhHHHHhhhhhcc-eeeeeecCCCC-CCCCCccEEEeccccccc
Q 027475           92 MHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGI-VRVADIKFPLP-YRAKSFPLVIVSDALDYL  169 (223)
Q Consensus        92 M~kVLHVGPdtC~VVs~LLkEeetEAWGVEPydiedad~~CKsLVrKGi-VRvADIkfpLP-YR~kSFSlVIVSDaLDyL  169 (223)
                      -.+||++|-........|.++.++++.|||-.     +.+..+-|+||+ |--.|+.-.|+ |..+||+.||.|++|..+
T Consensus        14 gsrVLDLGCGdG~LL~~L~~~k~v~g~GvEid-----~~~v~~cv~rGv~Viq~Dld~gL~~f~d~sFD~VIlsqtLQ~~   88 (193)
T PF07021_consen   14 GSRVLDLGCGDGELLAYLKDEKQVDGYGVEID-----PDNVAACVARGVSVIQGDLDEGLADFPDQSFDYVILSQTLQAV   88 (193)
T ss_pred             CCEEEecCCCchHHHHHHHHhcCCeEEEEecC-----HHHHHHHHHcCCCEEECCHHHhHhhCCCCCccEEehHhHHHhH
Confidence            37999999999999999999999999999832     345777799999 99999999997 999999999999999998


Q ss_pred             ChhhhccccccchhhccCceEEEee
Q 027475          170 SPKYLNKTLPDLARVASDGVLIFAG  194 (223)
Q Consensus       170 spryLNkTLPeLaRvsadglViF~G  194 (223)
                        ++-.+.|-|+.||...++|-|.-
T Consensus        89 --~~P~~vL~EmlRVgr~~IVsFPN  111 (193)
T PF07021_consen   89 --RRPDEVLEEMLRVGRRAIVSFPN  111 (193)
T ss_pred             --hHHHHHHHHHHHhcCeEEEEecC
Confidence              56778899999999999998763



Biosynthesis of methionine from homoserine in Pseudomonas putida takes place in three steps. The first step is the acylation of homoserine to yield an acyl-L-homoserine. This reaction is catalysed by the products of the metXW genes and is equivalent to the first step in enterobacteria, Gram-positive bacteria and fungi, except that in these microorganisms the reaction is catalysed by a single polypeptide (the product of the metA gene in Escherichia coli and the met5 gene product in Neurospora crassa). In P. putida, as in Gram-positive bacteria and certain fungi, the second and third steps are a direct sulphydrylation that converts the O-acyl-L-homoserine into homocysteine and further methylation to yield methionine. The latter reaction can be mediated by either of the two methionine synthetases present in the cells [].

>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 4e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 50.2 bits (119), Expect = 2e-07
 Identities = 36/244 (14%), Positives = 73/244 (29%), Gaps = 63/244 (25%)

Query: 23  ALQSKSRSSPLLSV-GL------VLVGAFLL---IGYAFSGSGIF----GGDKAAVSRIE 68
           AL  + R +  + + G+       +     L   +        IF        +  + +E
Sbjct: 143 ALL-ELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDF-KIFWLNLKNCNSPETVLE 200

Query: 69  GDFSCTSEIQRAIPILKKAY---GDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPY-- 123
                   +Q+ +  +   +    D    +        + +  LLK +        PY  
Sbjct: 201 -------MLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSK--------PYEN 245

Query: 124 ------DIEDA------DARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSD------A 165
                 ++++A      +  CK L+     +V D  F          L   S        
Sbjct: 246 CLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTD--FLSAATTTHISLDHHSMTLTPDEV 303

Query: 166 LDYLSPKYLNKTLPDLARVASDGV-LIFAGISSMFHLMKFSSDTW-----TEIHALMYTS 219
              L  KYL+    DL R          + I+        + D W      ++  ++ +S
Sbjct: 304 KSLLL-KYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESS 362

Query: 220 LDLQ 223
           L++ 
Sbjct: 363 LNVL 366


>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 97.43
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 97.39
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 97.38
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 97.28
3lcc_A235 Putative methyl chloride transferase; halide methy 97.19
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 97.14
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 97.12
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 97.11
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 97.1
3dtn_A234 Putative methyltransferase MM_2633; structural gen 97.05
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 97.01
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 96.9
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 96.84
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 96.82
3m70_A286 Tellurite resistance protein TEHB homolog; structu 96.7
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 96.62
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 96.62
3cc8_A230 Putative methyltransferase; structural genomics, j 96.53
3hnr_A220 Probable methyltransferase BT9727_4108; structural 96.52
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 96.48
3i9f_A170 Putative type 11 methyltransferase; structural gen 96.47
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 96.47
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 96.45
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 96.39
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 96.36
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 96.31
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 96.3
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 96.25
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 96.23
2i62_A265 Nicotinamide N-methyltransferase; structural genom 96.2
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 96.19
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 96.17
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 96.16
1xxl_A239 YCGJ protein; structural genomics, protein structu 96.12
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 96.12
3f4k_A257 Putative methyltransferase; structural genomics, P 95.96
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 95.9
3dh0_A219 SAM dependent methyltransferase; cystal structure, 95.87
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 95.87
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 95.86
3ege_A 261 Putative methyltransferase from antibiotic biosyn 95.8
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 95.78
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 95.77
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 95.74
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 95.74
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 95.73
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 95.67
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 95.6
1vl5_A260 Unknown conserved protein BH2331; putative methylt 95.54
2p7i_A250 Hypothetical protein; putative methyltransferase, 95.38
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 95.14
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 95.13
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 95.09
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 95.07
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 95.05
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 95.0
4hg2_A257 Methyltransferase type 11; structural genomics, PS 94.99
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 94.82
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 94.72
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 94.61
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 94.49
1wzn_A252 SAM-dependent methyltransferase; structural genomi 94.49
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 94.39
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 94.12
2r3s_A335 Uncharacterized protein; methyltransferase domain, 94.09
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 93.97
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 93.9
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 93.84
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 93.82
2kw5_A202 SLR1183 protein; structural genomics, northeast st 93.77
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 93.63
3dp7_A363 SAM-dependent methyltransferase; structural genomi 93.6
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 93.51
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 93.5
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 93.44
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 93.41
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 93.37
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 93.34
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 93.27
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 93.17
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 93.06
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 93.03
3m33_A226 Uncharacterized protein; structural genomics, PSI- 92.96
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 92.85
1vlm_A219 SAM-dependent methyltransferase; possible histamin 92.79
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 92.67
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 92.61
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 92.56
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 92.17
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 91.88
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 91.76
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 91.68
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 91.63
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 91.34
2fpo_A202 Methylase YHHF; structural genomics, putative meth 90.91
3ocj_A305 Putative exported protein; structural genomics, PS 90.74
1ne2_A200 Hypothetical protein TA1320; structural genomics, 90.69
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 90.14
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 89.82
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 89.81
2esr_A177 Methyltransferase; structural genomics, hypothetic 89.36
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 89.32
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 89.3
1jsx_A207 Glucose-inhibited division protein B; methyltransf 89.0
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 88.98
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 88.87
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 88.78
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 88.54
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 88.42
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 88.15
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 87.84
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 87.62
1yb2_A275 Hypothetical protein TA0852; structural genomics, 87.21
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 87.14
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 86.45
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 86.24
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 86.2
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 86.18
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 86.1
2o07_A304 Spermidine synthase; structural genomics, structur 85.98
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 85.69
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 85.67
1ws6_A171 Methyltransferase; structural genomics, riken stru 85.64
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 85.62
2pt6_A321 Spermidine synthase; transferase, structural genom 85.29
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 85.05
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 84.76
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 84.75
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 84.5
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 84.43
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 83.68
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 83.17
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 82.78
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 82.65
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 82.24
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 82.17
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 81.49
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 80.65
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 80.42
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 80.4
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 80.15
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
Probab=97.43  E-value=0.00024  Score=53.67  Aligned_cols=101  Identities=19%  Similarity=0.183  Sum_probs=71.3

Q ss_pred             cceeeeecCCcchhhhhcccccc-cccccccccc--ccchhHHHHhhh------hhcceeeeeecCCCCCCCCCccEEEe
Q 027475           92 MHKVLHVGPDTCSVVSTLLKEEE-TEAWGVEPYD--IEDADARCKSLV------HKGIVRVADIKFPLPYRAKSFPLVIV  162 (223)
Q Consensus        92 M~kVLHVGPdtC~VVs~LLkEee-tEAWGVEPyd--iedad~~CKsLV------rKGiVRvADIkfpLPYR~kSFSlVIV  162 (223)
                      -.+||.+|-.+......|.+... .+.+|||+.+  ++.+..+++..-      .+=-+..+|+ ..+|....+|++|+.
T Consensus        30 ~~~vLDiGcG~G~~~~~l~~~~~~~~v~gvD~s~~~~~~a~~~~~~~~~~~~~~~~v~~~~~d~-~~~~~~~~~fD~V~~  108 (219)
T 3jwg_A           30 AKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSL-VYRDKRFSGYDAATV  108 (219)
T ss_dssp             CCEEEEETCTTCHHHHHHHTSTTCCEEEEEESCHHHHHHHHHHHTGGGSCHHHHTTEEEEECCS-SSCCGGGTTCSEEEE
T ss_pred             CCEEEEecCCCCHHHHHHHhcCCCCEEEEEECCHHHHHHHHHHHHhhccccccCcceEEEeCcc-cccccccCCCCEEEE
Confidence            45999999999999888887654 6889998753  222333322110      0223455677 346777789999999


Q ss_pred             cccccccChhhhccccccchhhccC-ceEEEe
Q 027475          163 SDALDYLSPKYLNKTLPDLARVASD-GVLIFA  193 (223)
Q Consensus       163 SDaLDyLspryLNkTLPeLaRvsad-glViF~  193 (223)
                      ++++.|+++..+.+.|-++.|+-.. |++|++
T Consensus       109 ~~~l~~~~~~~~~~~l~~~~~~LkpgG~~i~~  140 (219)
T 3jwg_A          109 IEVIEHLDENRLQAFEKVLFEFTRPQTVIVST  140 (219)
T ss_dssp             ESCGGGCCHHHHHHHHHHHHTTTCCSEEEEEE
T ss_pred             HHHHHhCCHHHHHHHHHHHHHhhCCCEEEEEc
Confidence            9999999988888889999888665 544444



>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 97.6
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 97.29
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 96.88
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 96.56
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 96.5
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 96.34
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 95.93
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 95.87
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 95.42
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 95.18
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 95.15
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 94.78
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 94.73
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 94.67
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 93.7
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 92.82
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 92.65
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 91.77
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 91.31
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 90.72
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 85.52
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 83.75
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 83.33
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 82.99
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 82.41
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: CAC2371-like
domain: Hypothetical protein PH0226
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
Probab=97.60  E-value=3.7e-05  Score=55.83  Aligned_cols=113  Identities=25%  Similarity=0.312  Sum_probs=78.3

Q ss_pred             HHHhhhhHHHHHhccccceeeeecCCcchhhhhccccccccccccccccccchhHHHHhhhh-hc---ceeeeeecCCCC
Q 027475           76 EIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVH-KG---IVRVADIKFPLP  151 (223)
Q Consensus        76 eV~~aiP~LkkaYGdsM~kVLHVGPdtC~VVs~LLkEeetEAWGVEPydiedad~~CKsLVr-KG---iVRvADIkfpLP  151 (223)
                      +..+--|++++--.+. .+||-||-.|-...-.|-+ ...+.+|+++-  ++.-..||...+ +|   ....+|+. -||
T Consensus        23 ~~~~~~~~~~~~l~~~-~~ILDiGcG~G~~~~~la~-~~~~v~giD~S--~~~i~~ak~~~~~~~~~~~~~~~d~~-~l~   97 (226)
T d1ve3a1          23 RIETLEPLLMKYMKKR-GKVLDLACGVGGFSFLLED-YGFEVVGVDIS--EDMIRKAREYAKSRESNVEFIVGDAR-KLS   97 (226)
T ss_dssp             HHHHHHHHHHHSCCSC-CEEEEETCTTSHHHHHHHH-TTCEEEEEESC--HHHHHHHHHHHHHTTCCCEEEECCTT-SCC
T ss_pred             HHHHHHHHHHHhcCCC-CEEEEECCCcchhhhhHhh-hhccccccccc--ccchhhhhhhhccccccccccccccc-ccc
Confidence            4555566777644444 5799999999886665554 45688998864  233334443332 22   23344443 378


Q ss_pred             CCCCCccEEEecccccccChhhhccccccchhhccC-ceEEEe
Q 027475          152 YRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASD-GVLIFA  193 (223)
Q Consensus       152 YR~kSFSlVIVSDaLDyLspryLNkTLPeLaRvsad-glViF~  193 (223)
                      +...||++|+..+.+.|+++.-+++.|=+++|+-.. |..|+.
T Consensus        98 ~~~~~fD~I~~~~~l~~~~~~d~~~~l~~i~~~LkpgG~lii~  140 (226)
T d1ve3a1          98 FEDKTFDYVIFIDSIVHFEPLELNQVFKEVRRVLKPSGKFIMY  140 (226)
T ss_dssp             SCTTCEEEEEEESCGGGCCHHHHHHHHHHHHHHEEEEEEEEEE
T ss_pred             ccCcCceEEEEecchhhCChhHHHHHHHHHHHHcCcCcEEEEE
Confidence            888999999999999999999999999999998554 555544



>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure