Citrus Sinensis ID: 027488

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MATLYAPSILASKPLLSSRPQLTLGLRVGSPTLRLPSRAHSRSILTVRAGATDSEYSSKRSSSNEPRETIMLPGCDYNHWLIVMEFPKDPAPTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVSEETSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYVNGEIIPCTYPTYQPNKRKESKYVSKRYERRRDGPPAERRTRQAAGQSESASS
ccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHccHHHHHHcEEEEECcCECcEEEEEcHHHHHHHcccccEEEEcccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccc
*********************************************************************IMLPGCDYNHWLIVMEFPKDPAPTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVSEETSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYVNGEIIPCTYPT*****************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATLYAPSILASKPLLSSRPQLTLGLRVGSPTLRLPSRAHSRSILTVRAGATDSEYSSKRSSSNEPRETIMLPGCDYNHWLIVMEFPKDPAPTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVSEETSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYVNGEIIPCTYPTYQPNKRKESKYVSKRYERRRDGPPAERRTRQAAGQSESASS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DAG protein, chloroplastic Acts very early in chloroplast development, being required for expression of RNA polymerase beta subunit gene, and hence indirectly for subsequent expression of CAB and RBCS genes.probableQ38732

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2W2N, chain P
Confidence level:confident
Coverage over the Query: 78-159
View the alignment between query and template
View the model in PyMOL