BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 027501
(222 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2Z23|A Chain A, Crystal Structure Of Y.Pestis Oligo Peptide Binding
Protein Oppa With Tri-Lysine Ligand
Length = 517
Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 5/61 (8%)
Query: 94 QTIMEKLQSYKMRVALNFEG-FQYQLGDFQLRVGKVV---PTHSENLRGIVMEVEYLPIS 149
+T++EK K NF G Y+L D+ + V+ PT+ +N + ++ +V YLPIS
Sbjct: 169 KTVVEKFGE-KWTQPQNFVGNGAYKLKDWIVNERIVLERSPTYWDNAKTVINQVTYLPIS 227
Query: 150 S 150
S
Sbjct: 228 S 228
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.133 0.387
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,777,641
Number of Sequences: 62578
Number of extensions: 207396
Number of successful extensions: 581
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 579
Number of HSP's gapped (non-prelim): 6
length of query: 222
length of database: 14,973,337
effective HSP length: 95
effective length of query: 127
effective length of database: 9,028,427
effective search space: 1146610229
effective search space used: 1146610229
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)