Citrus Sinensis ID: 027509

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MASHDHHTHDHAHHHHHDNDHDHTHEKNHGDSTATSWVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLQ
cccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccccccEEEEEccccccccccccccccHHHHHHHHHcccccEEEEEccccCEECccccccccEEEEEEEcccccccccccccccccccccc
******************************************************SHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASHDHHTHDHAHHHHHDNDHDHTHEKNHGDSTATSWVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Urease accessory protein UreG Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG.probableA7HHN3
Urease accessory protein UreG Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG.probableQ02FC5
Urease accessory protein UreG Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG.probableQ2SYG0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GFO, chain A
Confidence level:confident
Coverage over the Query: 65-209
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1pq4, chain Aprobable Alignment | Template Structure