Citrus Sinensis ID: 027515

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MEQHDEQEHDVYGGEIPDEMDADIDVDEHEHEHDHDHDHEHEHDADNENEEDPNANSKDLEDMKKRLKEIEEEAGALREMQAKVEKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVSAKRTNIPGMKQFRGRRPNTFGFRGRRPFIPGVPFVPYGYG
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHccccccEEEEEcccccccHHHHHHHHHccccccEEEEEcccccccccEEEEEEccHHHHHHHHHcccccccccEEEEECccccccccccccccccccccccccccccccccccccccc
***********YG***PD********************************************************************************************SIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVS*****************NTFGFRGRRPFIPGVPFVPYGYG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQHDEQEHDVYGGEIPDEMDADIDVDEHEHEHDHDHDHEHEHDADNENEEDPNANSKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVSAKRTNIPGMKQFRGRRPNTFGFRGRRPFIPGVPFVPYGYG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polyadenylate-binding protein 2 Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product. Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail elongation reaction and controls also the poly(A) tail length. Increases the affinity of poly(A) polymerase for RNA. Binds to poly(A) and to poly(G) with high affinity. May protect the poly(A) tail from degradation.probableQ7KNF2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 106-189
View the alignment between query and template
View the model in PyMOL