Citrus Sinensis ID: 027537
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| 225424099 | 218 | PREDICTED: uncharacterized protein LOC10 | 0.945 | 0.963 | 0.618 | 5e-63 | |
| 297737759 | 225 | unnamed protein product [Vitis vinifera] | 0.945 | 0.933 | 0.618 | 8e-63 | |
| 255570681 | 229 | conserved hypothetical protein [Ricinus | 0.981 | 0.951 | 0.570 | 3e-55 | |
| 449434584 | 225 | PREDICTED: uncharacterized protein LOC10 | 0.968 | 0.955 | 0.512 | 1e-49 | |
| 388522569 | 216 | unknown [Lotus japonicus] | 0.950 | 0.976 | 0.493 | 9e-49 | |
| 18408968 | 215 | ubiquitin-related protein [Arabidopsis t | 0.936 | 0.967 | 0.515 | 4e-47 | |
| 297838571 | 216 | hypothetical protein ARALYDRAFT_475936 [ | 0.932 | 0.958 | 0.506 | 8e-46 | |
| 351727641 | 218 | uncharacterized protein LOC100500271 [Gl | 0.945 | 0.963 | 0.477 | 2e-43 | |
| 118485265 | 216 | unknown [Populus trichocarpa] | 0.945 | 0.972 | 0.526 | 1e-41 | |
| 351723003 | 218 | uncharacterized protein LOC100527121 [Gl | 0.950 | 0.967 | 0.475 | 1e-41 |
| >gi|225424099|ref|XP_002283125.1| PREDICTED: uncharacterized protein LOC100264466 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 246 bits (628), Expect = 5e-63, Method: Compositional matrix adjust.
Identities = 136/220 (61%), Positives = 165/220 (75%), Gaps = 10/220 (4%)
Query: 7 VDDLEPLFDYRRVQPHNLVFFDDDDTPPIP--CPKRTKVLNPAVGKNVGVDIRELEVVDC 64
++LEPLFDY RVQP N V DDDD+ P PKR K+ N + KN V +V+DC
Sbjct: 5 TEELEPLFDYSRVQPFNFVPLDDDDSDSSPNLTPKRKKLSNSSEEKNENV----TQVIDC 60
Query: 65 EEEEEEEEDWLPPPPK--VMVQKQLVEDSAIKELRLKKQELVSFAKSADDVIRAVEESVK 122
+E EEE DWLPPPPK V VQ QL EDS +K+LRLKKQEL+ FA+SA DV+R VEES K
Sbjct: 61 KENEEE--DWLPPPPKLSVDVQNQLGEDSTLKQLRLKKQELLLFAESAKDVLRTVEESAK 118
Query: 123 RKLDSSMPAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKV 182
R+L SS+ +++E+ + + SKP ERAKIV+SIQDK GLKQFR+Y DDKFERLFKMYADK+
Sbjct: 119 RELGSSLQSSVESVASQPSKPPCERAKIVISIQDKDGLKQFRIYMDDKFERLFKMYADKL 178
Query: 183 NLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT 222
LD ++L+FCFDGDKI P ATP L MEDNDI+EVH K +
Sbjct: 179 KLDLKSLIFCFDGDKISPTATPDELGMEDNDIVEVHIKSS 218
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297737759|emb|CBI26960.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255570681|ref|XP_002526295.1| conserved hypothetical protein [Ricinus communis] gi|223534376|gb|EEF36084.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449434584|ref|XP_004135076.1| PREDICTED: uncharacterized protein LOC101214853 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388522569|gb|AFK49346.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|18408968|ref|NP_564924.1| ubiquitin-related protein [Arabidopsis thaliana] gi|21554742|gb|AAM63677.1| unknown [Arabidopsis thaliana] gi|88193818|gb|ABD42998.1| At1g68185 [Arabidopsis thaliana] gi|332196640|gb|AEE34761.1| ubiquitin-related protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297838571|ref|XP_002887167.1| hypothetical protein ARALYDRAFT_475936 [Arabidopsis lyrata subsp. lyrata] gi|297333008|gb|EFH63426.1| hypothetical protein ARALYDRAFT_475936 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|351727641|ref|NP_001235632.1| uncharacterized protein LOC100500271 [Glycine max] gi|255629887|gb|ACU15294.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|118485265|gb|ABK94492.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351723003|ref|NP_001235216.1| uncharacterized protein LOC100527121 [Glycine max] gi|255631604|gb|ACU16169.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| TAIR|locus:505006207 | 215 | AT1G68185 "AT1G68185" [Arabido | 0.936 | 0.967 | 0.524 | 1.5e-51 | |
| WB|WBGene00004888 | 91 | smo-1 [Caenorhabditis elegans | 0.337 | 0.824 | 0.407 | 1.4e-08 | |
| UNIPROTKB|P55853 | 91 | smo-1 "Small ubiquitin-related | 0.337 | 0.824 | 0.407 | 1.4e-08 | |
| ZFIN|ZDB-GENE-120215-155 | 94 | sumo2a "SMT3 suppressor of mif | 0.292 | 0.691 | 0.439 | 2.4e-08 | |
| UNIPROTKB|F1M2K3 | 94 | F1M2K3 "Uncharacterized protei | 0.405 | 0.957 | 0.340 | 3.2e-08 | |
| UNIPROTKB|J9P2X4 | 133 | LOC100856530 "Uncharacterized | 0.423 | 0.706 | 0.326 | 4.2e-08 | |
| UNIPROTKB|Q5ZJM9 | 95 | SUMO2 "Small ubiquitin-related | 0.396 | 0.926 | 0.337 | 5.5e-08 | |
| UNIPROTKB|G5E5Y5 | 95 | SUMO2 "Small ubiquitin-related | 0.405 | 0.947 | 0.340 | 5.5e-08 | |
| UNIPROTKB|P61955 | 95 | SUMO2 "Small ubiquitin-related | 0.396 | 0.926 | 0.337 | 5.5e-08 | |
| UNIPROTKB|E2RGN5 | 95 | SUMO2 "Uncharacterized protein | 0.396 | 0.926 | 0.337 | 5.5e-08 |
| TAIR|locus:505006207 AT1G68185 "AT1G68185" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 535 (193.4 bits), Expect = 1.5e-51, P = 1.5e-51
Identities = 116/221 (52%), Positives = 146/221 (66%)
Query: 6 EVDDLEPLFDYRRVQPHNLVFFDDDDTPP--IPCPKRTKVLNPAVGKNVGVDIRELEVVD 63
E +DLEPLFDYRRVQP N V DDDD P PK+ K + V K + D++ +EV
Sbjct: 4 EGEDLEPLFDYRRVQPANFVCIDDDDDDASVTPIPKKAKT-SQTVEK-LDDDVKVIEVTG 61
Query: 64 CXXXXXXXXDWLPPPPKVMVQKQL--VEDSAIKELRLKKQELVSFAKSADDVIRAVEESV 121
DWL PPPKV+ K VEDS IK LR KK EL+SF K+ DV++ VEES
Sbjct: 62 -------DDDWLLPPPKVIFDKSKDSVEDSTIKALRSKKMELMSFTKTVGDVMQEVEESA 114
Query: 122 KRKLDSSMPAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADK 181
KR+++ S + E ++ S+P +RAKIV++IQDK G K RV+AD+KFER+ K+Y DK
Sbjct: 115 KREVEESRNPSSETAAQLPSEPTNDRAKIVITIQDKDGQKTLRVFADEKFERVIKLYTDK 174
Query: 182 VNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT 222
LD +NLVF FDGDKI P TP+ L MED+D+IEVHTKKT
Sbjct: 175 AKLDPQNLVFIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215
|
|
| WB|WBGene00004888 smo-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P55853 smo-1 "Small ubiquitin-related modifier" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-120215-155 sumo2a "SMT3 suppressor of mif two 3 homolog 2a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M2K3 F1M2K3 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P2X4 LOC100856530 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZJM9 SUMO2 "Small ubiquitin-related modifier 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E5Y5 SUMO2 "Small ubiquitin-related modifier 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P61955 SUMO2 "Small ubiquitin-related modifier 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RGN5 SUMO2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| cd01763 | 87 | cd01763, Sumo, Small ubiquitin-related modifier (S | 2e-13 | |
| pfam11976 | 72 | pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO- | 2e-10 | |
| COG5227 | 103 | COG5227, SMT3, Ubiquitin-like protein (sentrin) [P | 7e-09 |
| >gnl|CDD|176359 cd01763, Sumo, Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
Score = 63.0 bits (154), Expect = 2e-13
Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
Query: 148 AKIVVSIQDKGGLK-QFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPAS 206
I + ++ + G + F++ ++L + Y + L ++ F FDG +I TP
Sbjct: 10 EHINLKVKGQDGNEVFFKIKRSTPLKKLMEAYCQRQGLSMNSVRFLFDGQRIRDNQTPDD 69
Query: 207 LEMEDNDIIEVHTKKT 222
L MED D IEV ++T
Sbjct: 70 LGMEDGDEIEVMLEQT 85
|
Small ubiquitin-related modifier (SUMO) proteins are conjugated to numerous intracellular targets and serve to modulate protein interaction, localization, activity or stability. SUMO (also known as "Smt3" and "sentrin" in other organisms) is linked to several different pathways, including nucleocytoplasmic transport. Attachment of SUMO to targets proteins is stimulated by PIAS (Protein inhibitor of activated STATs) proteins which serve as E3-like ligases. Length = 87 |
| >gnl|CDD|192903 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO-like | Back alignment and domain information |
|---|
| >gnl|CDD|227552 COG5227, SMT3, Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| KOG1769 | 99 | consensus Ubiquitin-like proteins [Posttranslation | 99.93 | |
| COG5227 | 103 | SMT3 Ubiquitin-like protein (sentrin) [Posttransla | 99.86 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 99.84 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 99.81 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 98.93 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 98.65 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 98.63 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 98.57 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 98.48 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 98.46 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 98.43 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 98.43 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 98.35 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 98.28 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 98.27 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 98.23 | |
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 98.23 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 98.23 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 98.22 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 98.22 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 98.12 | |
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 98.07 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 98.05 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 98.0 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 97.86 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 97.81 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 97.6 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 97.54 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 97.52 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 97.51 | |
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 97.49 | |
| KOG0010 | 493 | consensus Ubiquitin-like protein [Posttranslationa | 97.08 | |
| cd01789 | 84 | Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol | 96.81 | |
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 96.61 | |
| cd01815 | 75 | BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC | 96.46 | |
| KOG0005 | 70 | consensus Ubiquitin-like protein [Cell cycle contr | 96.39 | |
| PF14560 | 87 | Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K | 96.36 | |
| PF08817 | 79 | YukD: WXG100 protein secretion system (Wss), prote | 95.32 | |
| cd01801 | 77 | Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- | 95.28 | |
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 95.1 | |
| PLN02560 | 308 | enoyl-CoA reductase | 95.1 | |
| cd01814 | 113 | NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT | 94.79 | |
| PRK08364 | 70 | sulfur carrier protein ThiS; Provisional | 94.18 | |
| PF00789 | 82 | UBX: UBX domain; InterPro: IPR001012 The UBX domai | 93.52 | |
| KOG0011 | 340 | consensus Nucleotide excision repair factor NEF2, | 93.14 | |
| PF13881 | 111 | Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB | 92.94 | |
| KOG0003 | 128 | consensus Ubiquitin/60s ribosomal protein L40 fusi | 92.84 | |
| PF00564 | 84 | PB1: PB1 domain; InterPro: IPR000270 The Phox and | 90.89 | |
| smart00666 | 81 | PB1 PB1 domain. Phox and Bem1p domain, present in | 90.7 | |
| cd01795 | 107 | USP48_C USP ubiquitin-specific protease. The USP ( | 90.31 | |
| cd06408 | 86 | PB1_NoxR The PB1 domain is present in the Epichloe | 89.82 | |
| cd05992 | 81 | PB1 The PB1 domain is a modular domain mediating s | 88.39 | |
| cd06407 | 82 | PB1_NLP A PB1 domain is present in NIN like protei | 86.44 | |
| cd00754 | 80 | MoaD Ubiquitin domain of MoaD-like proteins. MoaD | 86.28 | |
| PF03671 | 76 | Ufm1: Ubiquitin fold modifier 1 protein; InterPro: | 86.23 | |
| PRK06437 | 67 | hypothetical protein; Provisional | 85.87 | |
| cd06396 | 81 | PB1_NBR1 The PB1 domain is an essential part of NB | 85.49 | |
| cd01774 | 85 | Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i | 85.18 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 84.94 | |
| cd06409 | 86 | PB1_MUG70 The MUG70 protein is a product of the me | 84.58 | |
| cd06406 | 80 | PB1_P67 A PB1 domain is present in p67 proteins wh | 84.46 | |
| PF12436 | 249 | USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-sp | 83.69 | |
| cd01766 | 82 | Ufm1 Urm1-like ubiquitin domain. Ufm1 (ubiquitin-f | 83.19 | |
| KOG4248 | 1143 | consensus Ubiquitin-like protein, regulator of apo | 82.71 | |
| PRK07440 | 70 | hypothetical protein; Provisional | 81.7 | |
| smart00166 | 80 | UBX Domain present in ubiquitin-regulatory protein | 81.33 | |
| cd01767 | 77 | UBX UBX (ubiquitin regulatory X) domain. The UBX ( | 80.27 |
| >KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.93 E-value=8.3e-26 Score=176.46 Aligned_cols=76 Identities=34% Similarity=0.590 Sum_probs=73.5
Q ss_pred CCcEEEEEEeCCce-EEEEEcCCChHHHHHHHHHHHcCCCCCceEEEECCcccCCCCCcccCCCCCCcEEEEEeccC
Q 027537 147 RAKIVVSIQDKGGL-KQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT 222 (222)
Q Consensus 147 ~~kItIkV~~qdg~-v~FkIk~tT~L~KLf~aYaer~gl~~~~lrF~FDG~rI~~~~TP~sLgMEDGDiIDV~ikQ~ 222 (222)
..+|+|+|.++++. ++|+|+++|+|.|||++||++.|++.++|||+|||+||..++||++|+|||||+|+|+..|.
T Consensus 18 ~~hi~LKV~gqd~~~~~Fkikr~t~LkKLM~aYc~r~Gl~~~s~RFlFdG~rI~~~~TP~~L~mEd~D~Iev~~~q~ 94 (99)
T KOG1769|consen 18 SEHINLKVKGQDGSVVVFKIKRHTPLKKLMKAYCERQGLSMNSLRFLFDGQRIRETHTPADLEMEDGDEIEVVQEQT 94 (99)
T ss_pred cceEEEEEecCCCCEEEEEeecCChHHHHHHHHHHHcCCccceEEEEECCcCcCCCCChhhhCCcCCcEEEEEeecc
Confidence 68999999998886 79999999999999999999999999999999999999999999999999999999999884
|
|
| >COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP | Back alignment and domain information |
|---|
| >KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A | Back alignment and domain information |
|---|
| >PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] | Back alignment and domain information |
|---|
| >cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
| >cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >PRK08364 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast | Back alignment and domain information |
|---|
| >KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A | Back alignment and domain information |
|---|
| >KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins | Back alignment and domain information |
|---|
| >smart00666 PB1 PB1 domain | Back alignment and domain information |
|---|
| >cd01795 USP48_C USP ubiquitin-specific protease | Back alignment and domain information |
|---|
| >cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA | Back alignment and domain information |
|---|
| >cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity | Back alignment and domain information |
|---|
| >cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) | Back alignment and domain information |
|---|
| >cd00754 MoaD Ubiquitin domain of MoaD-like proteins | Back alignment and domain information |
|---|
| >PF03671 Ufm1: Ubiquitin fold modifier 1 protein; InterPro: IPR005375 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >PRK06437 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 | Back alignment and domain information |
|---|
| >cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain | Back alignment and domain information |
|---|
| >cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis | Back alignment and domain information |
|---|
| >PF12436 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-specific protease 7; InterPro: IPR024729 This domain is found in eukaryotes, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >cd01766 Ufm1 Urm1-like ubiquitin domain | Back alignment and domain information |
|---|
| >KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07440 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00166 UBX Domain present in ubiquitin-regulatory proteins | Back alignment and domain information |
|---|
| >cd01767 UBX UBX (ubiquitin regulatory X) domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 222 | ||||
| 1u4a_A | 87 | Solution Structure Of Human Sumo-3 C47s Length = 87 | 3e-06 | ||
| 2k1f_A | 88 | Sumo-3 From Drosophila Melanogaster (Dsmt3) Length | 3e-06 | ||
| 1wz0_A | 104 | Solution Structure Of Human Sumo-2 (Smt3b), A Ubiqu | 3e-06 | ||
| 2awt_A | 95 | Solution Structure Of Human Small Ubiquitin-Like Mo | 3e-06 | ||
| 2d07_B | 93 | Crystal Structure Of Sumo-3-Modified Thymine-Dna Gl | 3e-06 | ||
| 2io3_B | 81 | Crystal Structure Of Human Senp2 In Complex With Ra | 4e-06 | ||
| 2io0_B | 91 | Crystal Structure Of Human Senp2 In Complex With Pr | 4e-06 | ||
| 2ckh_B | 79 | Senp1-sumo2 Complex Length = 79 | 4e-06 | ||
| 2io1_B | 94 | Crystal Structure Of Human Senp2 In Complex With Pr | 4e-06 | ||
| 2iyd_B | 81 | Senp1 Covalent Complex With Sumo-2 Length = 81 | 5e-06 | ||
| 3uin_B | 80 | Complex Between Human Rangap1-Sumo2, Ubc9 And The I | 5e-06 | ||
| 3tix_A | 207 | Crystal Structure Of The Chp1-Tas3 Complex Core Len | 8e-06 | ||
| 2eke_C | 106 | Structure Of A Sumo-Binding-Motif Mimic Bound To Sm | 1e-05 | ||
| 3qht_A | 98 | Crystal Structure Of The Monobody Ysmb-1 Bound To Y | 1e-05 | ||
| 1wm3_A | 72 | Crystal Structure Of Human Sumo-2 Protein Length = | 1e-05 | ||
| 1l2n_A | 101 | Smt3 Solution Structure Length = 101 | 1e-05 | ||
| 1euv_B | 86 | X-Ray Structure Of The C-Terminal Ulp1 Protease Dom | 1e-05 | ||
| 3v7o_A | 227 | Crystal Structure Of The C-Terminal Domain Of Ebola | 1e-05 | ||
| 1wm2_A | 78 | Crystal Structure Of Human Sumo-2 Protein Length = | 1e-05 | ||
| 3uqb_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-05 | ||
| 3uf8_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-05 | ||
| 3uqa_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-05 | ||
| 4ggq_C | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-05 | ||
| 3vaw_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 2e-05 | ||
| 3v62_A | 84 | Structure Of The S. Cerevisiae Srs2 C-Terminal Doma | 2e-05 | ||
| 3v60_A | 84 | Structure Of S. Cerevisiae Pcna Conjugated To Sumo | 2e-05 | ||
| 3pge_A | 200 | Structure Of Sumoylated Pcna Length = 200 | 2e-05 | ||
| 3ix6_A | 360 | Crystal Structure Of Thymidylate Synthase Thya From | 3e-05 | ||
| 4da1_A | 389 | Crystal Structure Of Branched-Chain Alpha-Ketoacid | 9e-05 | ||
| 3rzw_C | 99 | Crystal Structure Of The Monobody Ysmb-9 Bound To H | 2e-04 | ||
| 2uyz_B | 79 | Non-Covalent Complex Between Ubc9 And Sumo1 Length | 5e-04 | ||
| 2iy0_B | 82 | Senp1 (Mutant) Sumo1 Rangap Length = 82 | 7e-04 | ||
| 1a5r_A | 103 | Structure Determination Of The Small Ubiquitin-Rela | 7e-04 | ||
| 1y8r_C | 97 | Sumo E1 Activating Enzyme Sae1-Sae2-Sumo1-Mg-Atp Co | 7e-04 | ||
| 2g4d_B | 78 | Crystal Structure Of Human Senp1 Mutant (C603s) In | 7e-04 | ||
| 2kqs_A | 99 | Phosphorylation Of Sumo-Interacting Motif By Ck2 En | 7e-04 | ||
| 2bf8_B | 77 | Crystal Structure Of Sumo Modified Ubiquitin Conjug | 7e-04 | ||
| 2iy1_B | 83 | Senp1 (Mutant) Full Length Sumo1 Length = 83 | 7e-04 | ||
| 1z5s_B | 82 | Crystal Structure Of A Complex Between Ubc9, Sumo-1 | 8e-04 | ||
| 1tgz_B | 80 | Structure Of Human Senp2 In Complex With Sumo-1 Len | 8e-04 |
| >pdb|1U4A|A Chain A, Solution Structure Of Human Sumo-3 C47s Length = 87 | Back alignment and structure |
|
| >pdb|2K1F|A Chain A, Sumo-3 From Drosophila Melanogaster (Dsmt3) Length = 88 | Back alignment and structure |
| >pdb|1WZ0|A Chain A, Solution Structure Of Human Sumo-2 (Smt3b), A Ubiquitin- Like Protein Length = 104 | Back alignment and structure |
| >pdb|2AWT|A Chain A, Solution Structure Of Human Small Ubiquitin-Like Modifier Protein Isoform 2 (Sumo-2) Length = 95 | Back alignment and structure |
| >pdb|2D07|B Chain B, Crystal Structure Of Sumo-3-Modified Thymine-Dna Glycosylase Length = 93 | Back alignment and structure |
| >pdb|2IO3|B Chain B, Crystal Structure Of Human Senp2 In Complex With Rangap1- Sumo-2 Length = 81 | Back alignment and structure |
| >pdb|2IO0|B Chain B, Crystal Structure Of Human Senp2 In Complex With Presumo-2 Length = 91 | Back alignment and structure |
| >pdb|2CKH|B Chain B, Senp1-sumo2 Complex Length = 79 | Back alignment and structure |
| >pdb|2IO1|B Chain B, Crystal Structure Of Human Senp2 In Complex With Presumo-3 Length = 94 | Back alignment and structure |
| >pdb|2IYD|B Chain B, Senp1 Covalent Complex With Sumo-2 Length = 81 | Back alignment and structure |
| >pdb|3UIN|B Chain B, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Length = 80 | Back alignment and structure |
| >pdb|3TIX|A Chain A, Crystal Structure Of The Chp1-Tas3 Complex Core Length = 207 | Back alignment and structure |
| >pdb|2EKE|C Chain C, Structure Of A Sumo-Binding-Motif Mimic Bound To Smt3p- Ubc9p: Conservation Of A Noncovalent Ubiquitin-Like Protein-E2 Complex As A Platform For Selective Interactions Within A Sumo Pathway Length = 106 | Back alignment and structure |
| >pdb|3QHT|A Chain A, Crystal Structure Of The Monobody Ysmb-1 Bound To Yeast Sumo Length = 98 | Back alignment and structure |
| >pdb|1WM3|A Chain A, Crystal Structure Of Human Sumo-2 Protein Length = 72 | Back alignment and structure |
| >pdb|1L2N|A Chain A, Smt3 Solution Structure Length = 101 | Back alignment and structure |
| >pdb|1EUV|B Chain B, X-Ray Structure Of The C-Terminal Ulp1 Protease Domain In Complex With Smt3, The Yeast Ortholog Of Sumo Length = 86 | Back alignment and structure |
| >pdb|3V7O|A Chain A, Crystal Structure Of The C-Terminal Domain Of Ebola Virus Vp30 (Strain Reston-89) Length = 227 | Back alignment and structure |
| >pdb|1WM2|A Chain A, Crystal Structure Of Human Sumo-2 Protein Length = 78 | Back alignment and structure |
| >pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 | Back alignment and structure |
| >pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|3V62|A Chain A, Structure Of The S. Cerevisiae Srs2 C-Terminal Domain In Complex With Pcna Conjugated To Sumo On Lysine 164 Length = 84 | Back alignment and structure |
| >pdb|3V60|A Chain A, Structure Of S. Cerevisiae Pcna Conjugated To Sumo On Lysine 164 Length = 84 | Back alignment and structure |
| >pdb|3PGE|A Chain A, Structure Of Sumoylated Pcna Length = 200 | Back alignment and structure |
| >pdb|3IX6|A Chain A, Crystal Structure Of Thymidylate Synthase Thya From Brucella Melitensis Length = 360 | Back alignment and structure |
| >pdb|4DA1|A Chain A, Crystal Structure Of Branched-Chain Alpha-Ketoacid Dehydrogenase Phosphatase With Mg (Ii) Ions At The Active Site Length = 389 | Back alignment and structure |
| >pdb|3RZW|C Chain C, Crystal Structure Of The Monobody Ysmb-9 Bound To Human Sumo1 Length = 99 | Back alignment and structure |
| >pdb|2UYZ|B Chain B, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 79 | Back alignment and structure |
| >pdb|2IY0|B Chain B, Senp1 (Mutant) Sumo1 Rangap Length = 82 | Back alignment and structure |
| >pdb|1A5R|A Chain A, Structure Determination Of The Small Ubiquitin-Related Modifier Sumo-1, Nmr, 10 Structures Length = 103 | Back alignment and structure |
| >pdb|1Y8R|C Chain C, Sumo E1 Activating Enzyme Sae1-Sae2-Sumo1-Mg-Atp Complex Length = 97 | Back alignment and structure |
| >pdb|2G4D|B Chain B, Crystal Structure Of Human Senp1 Mutant (C603s) In Complex With Sumo-1 Length = 78 | Back alignment and structure |
| >pdb|2KQS|A Chain A, Phosphorylation Of Sumo-Interacting Motif By Ck2 Enhances Daxx Sumo Binding Activity Length = 99 | Back alignment and structure |
| >pdb|2BF8|B Chain B, Crystal Structure Of Sumo Modified Ubiquitin Conjugating Enzyme E2-25k Length = 77 | Back alignment and structure |
| >pdb|2IY1|B Chain B, Senp1 (Mutant) Full Length Sumo1 Length = 83 | Back alignment and structure |
| >pdb|1Z5S|B Chain B, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 82 | Back alignment and structure |
| >pdb|1TGZ|B Chain B, Structure Of Human Senp2 In Complex With Sumo-1 Length = 80 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 9e-20 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 2e-19 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 4e-19 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 4e-19 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 4e-19 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 1e-18 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 2e-18 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 3e-18 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 3e-18 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 4e-18 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 4e-18 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 5e-18 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 2e-17 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 2e-17 | |
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 1e-10 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 5e-09 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 6e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 |
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Length = 106 | Back alignment and structure |
|---|
Score = 80.0 bits (197), Expect = 9e-20
Identities = 25/97 (25%), Positives = 42/97 (43%)
Query: 126 DSSMPAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLD 185
L +V I + + D F++ RL + +A + +
Sbjct: 8 HHHSQDPLVPRGSEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKE 67
Query: 186 QENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT 222
++L F +DG +I + TP L+MEDNDIIE H ++
Sbjct: 68 MDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQI 104
|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Length = 91 | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Length = 227 | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Length = 207 | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Length = 94 | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 104 | Back alignment and structure |
|---|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Length = 79 | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Length = 79 | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Length = 97 | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Length = 110 | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Length = 93 | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Length = 72 | Back alignment and structure |
|---|
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Length = 200 | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Length = 82 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 99.94 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 99.92 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 99.91 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 99.89 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 99.89 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 99.89 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 99.89 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 99.89 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 99.88 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 99.88 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 99.88 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 99.87 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 99.87 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 99.83 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 99.82 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 99.79 | |
| 3ix6_A | 360 | TS, tsase, thymidylate synthase; niaid, ssgcid, se | 99.77 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 99.76 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 99.47 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 99.42 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 98.89 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 98.85 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 98.85 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 98.8 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 98.79 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 98.79 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 98.77 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 98.77 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 98.76 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 98.76 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 98.75 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 98.75 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 98.72 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 98.7 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 98.68 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 98.63 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 98.62 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 98.61 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 98.6 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 98.6 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 98.59 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 98.55 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 98.55 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 98.55 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 98.54 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 98.53 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 98.52 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 98.51 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 98.47 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 98.46 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 98.46 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 98.43 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 98.4 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 98.4 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 98.39 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 98.36 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 98.31 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 98.28 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 98.26 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 98.25 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 97.57 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 98.24 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 98.24 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 98.23 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 98.22 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 98.2 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 98.18 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 98.17 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 98.16 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 98.16 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 98.13 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 98.1 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 98.06 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 98.04 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 98.02 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 98.01 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 98.0 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 98.0 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 97.94 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 97.92 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 97.86 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 97.85 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 97.79 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 97.77 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 97.77 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 97.76 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 97.73 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 97.73 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 97.69 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 97.67 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 97.66 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 97.58 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 97.53 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 97.51 | |
| 4ajy_B | 118 | Transcription elongation factor B polypeptide 2; E | 97.48 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 97.47 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 97.45 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 97.4 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 97.37 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 97.33 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 97.1 | |
| 4b6w_A | 86 | Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik | 97.03 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 96.98 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 96.95 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 96.81 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 96.11 | |
| 2dzm_A | 100 | FAS-associated factor 1; ubiquitin-like domain, HF | 96.09 | |
| 2bps_A | 81 | YUKD protein; ubiquitin-like protein, ubiquitin; 2 | 95.85 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 95.0 | |
| 1ryj_A | 70 | Unknown; beta/alpha protein, structural genomics, | 94.33 | |
| 3qx1_A | 84 | FAS-associated factor 1; UBX, protein binding, P97 | 92.1 | |
| 2cr5_A | 109 | Reproduction 8; UBX domain, D0H8S2298E protein, st | 91.75 | |
| 3jyu_A | 231 | Ubiquitin carboxyl-terminal hydrolase; domain in u | 91.7 | |
| 4efo_A | 94 | Serine/threonine-protein kinase TBK1; ubiquitin li | 90.06 | |
| 3rpf_C | 74 | Molybdopterin converting factor, subunit 1 (MOAD); | 89.64 | |
| 2daj_A | 91 | KIAA0977 protein, COBL-like 1; ubiquitin-like doma | 89.28 | |
| 4a3p_A | 217 | Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H | 88.08 | |
| 1oey_A | 83 | P67-PHOX, neutrophil cytosol factor 2; immune syst | 87.59 | |
| 2kvr_A | 130 | Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi | 86.57 | |
| 2dzk_A | 109 | UBX domain-containing protein 2; ubiquitin-like fo | 86.43 | |
| 1j0g_A | 92 | Hypothetical protein 1810045K17; ubiquitin-like fo | 86.17 | |
| 1vd2_A | 89 | Protein kinase C, IOTA type; PB1 domain, OPCA moti | 85.66 | |
| 2l32_A | 74 | Small archaeal modifier protein 2; protein BIN; NM | 82.58 | |
| 1wj4_A | 124 | KIAA0794 protein; UBX domain, beta-grAsp fold, str | 81.08 |
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.94 E-value=2.6e-27 Score=182.92 Aligned_cols=91 Identities=14% Similarity=0.280 Sum_probs=80.7
Q ss_pred chhhhhhhccCCCCcCCCCcEEEEEEeCCceEEEEEcCCChHHHHHHHHHHHcCCCCCceEEEECCcccCCCCCcccCCC
Q 027537 130 PAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEM 209 (222)
Q Consensus 130 ~~e~~~~~~~~~~p~~~~~kItIkV~~qdg~v~FkIk~tT~L~KLf~aYaer~gl~~~~lrF~FDG~rI~~~~TP~sLgM 209 (222)
.++++++++++. |. .+.+|+|+|++.+++++|+||++|+|+|||++||++.|++++++||+|||.||++++||++|||
T Consensus 4 ~~~~~~~~~~~~-~~-~~~~IniKV~~~g~ev~FkIK~tt~l~KL~~aYc~r~gv~~~sirFlfDG~rI~~~~TP~~L~m 81 (95)
T 2l76_A 4 EDEVVLVEGPTL-PE-TPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKL 81 (95)
T ss_dssp CCCCCSSSCCCC-CS-CCCCEEEEEECSSSEEEEEECSSSCTHHHHHHHHHHHTSCGGGEEEEETTEECCTTSCHHHHTC
T ss_pred cccEEEecCCCC-CC-CCCeEEEEEEcCCcEEEEEEecCChHHHHHHHHHhhcCCChhhEEEEECCcCCCCCCCHhHcCC
Confidence 456666666654 43 5788999999776679999999999999999999999999999999999999999999999999
Q ss_pred CCCcEEEEEeccC
Q 027537 210 EDNDIIEVHTKKT 222 (222)
Q Consensus 210 EDGDiIDV~ikQ~ 222 (222)
||||+|||++-.|
T Consensus 82 eD~DiID~~~~~~ 94 (95)
T 2l76_A 82 GVADIIDCVVLTS 94 (95)
T ss_dssp CSSCEEEEEECCC
T ss_pred CCCCEEEEEEecC
Confidence 9999999998654
|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A | Back alignment and structure |
|---|
| >3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 | Back alignment and structure |
|---|
| >1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A | Back alignment and structure |
|---|
| >2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} | Back alignment and structure |
|---|
| >4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A | Back alignment and structure |
|---|
| >1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 | Back alignment and structure |
|---|
| >2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A | Back alignment and structure |
|---|
| >1j0g_A Hypothetical protein 1810045K17; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.6 PDB: 1wxs_A 1l7y_A | Back alignment and structure |
|---|
| >1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A | Back alignment and structure |
|---|
| >2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} | Back alignment and structure |
|---|
| >1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 222 | ||||
| d1wm3a_ | 72 | d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: | 3e-17 | |
| d2uyzb1 | 77 | d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human | 4e-14 | |
| d1euvb_ | 79 | d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea | 7e-13 |
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: SUMO-2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 71.3 bits (175), Expect = 3e-17
Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
Query: 150 IVVSIQDKGGLK-QFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLE 208
I + + + G QF++ +L K Y ++ L + F FDG I TPA LE
Sbjct: 2 INLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLE 61
Query: 209 MEDNDIIEVH 218
MED D I+V
Sbjct: 62 MEDEDTIDVF 71
|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 99.89 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 99.86 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 98.83 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 98.73 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 98.71 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 98.71 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 98.69 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 98.63 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 98.63 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 98.6 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 98.58 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 98.57 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 98.55 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 98.5 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 98.5 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 98.5 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 98.4 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 98.39 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 98.3 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 98.3 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 98.27 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 98.23 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 98.17 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 98.17 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 98.13 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 98.12 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 98.05 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 98.03 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 98.01 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 97.99 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 97.98 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 97.91 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 97.65 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 97.5 | |
| d1v6ea_ | 95 | Ubiquitin-like domain of tubulin folding cofactor | 97.37 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 97.27 | |
| d1t0ya_ | 90 | Ubiquitin-like domain of tubulin folding cofactor | 97.12 | |
| d1x1ma1 | 94 | Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta | 96.91 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 96.05 | |
| d2cr5a1 | 96 | UBX domain-containing protein 6 (Reproduction 8) { | 94.94 | |
| d1ip9a_ | 85 | Bud emergence mediator Bemp1 {Baker's yeast (Sacch | 93.04 | |
| d1i42a_ | 89 | p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | 88.5 | |
| d1h8ca_ | 82 | Fas-associated factor 1, Faf1 {Human (Homo sapiens | 88.36 | |
| d1vjka_ | 88 | Molybdopterin synthase subunit MoaD {Pyrococcus fu | 85.74 | |
| d1y8xb1 | 92 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 84.58 | |
| d1wf9a1 | 94 | NPL4-like protein 1 {Thale cress (Arabidopsis thal | 80.46 |
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: SUMO-2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91 E-value=6.5e-25 Score=158.06 Aligned_cols=71 Identities=34% Similarity=0.611 Sum_probs=68.8
Q ss_pred cEEEEEEeCCce-EEEEEcCCChHHHHHHHHHHHcCCCCCceEEEECCcccCCCCCcccCCCCCCcEEEEEe
Q 027537 149 KIVVSIQDKGGL-KQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHT 219 (222)
Q Consensus 149 kItIkV~~qdg~-v~FkIk~tT~L~KLf~aYaer~gl~~~~lrF~FDG~rI~~~~TP~sLgMEDGDiIDV~i 219 (222)
||+|+|++++|. ++|+|+++++|++||++||++.|++++.++|+|||++|.+++||++|||||||+|+||.
T Consensus 1 ~I~lkv~~~~g~~v~f~vk~~t~l~kl~~~y~~~~~~~~~~~~f~fdG~~i~~~~Tp~~l~med~D~Idv~~ 72 (72)
T d1wm3a_ 1 HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQ 72 (72)
T ss_dssp CEEEEEECTTSCEEEEEECTTSCTHHHHHHHHHHHTCCTTTCEEEETTEECCTTCCTTTTTCCTTEEEEEEC
T ss_pred CEEEEEECCCCCEEEEEEcCCChHHHHHHHHHHHhCCCccceEEEECCEEcCCCCCHHHcCCCCCCEEEEEC
Confidence 699999999986 89999999999999999999999999999999999999999999999999999999984
|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|