Citrus Sinensis ID: 027537


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MADLTEVDDLEPLFDYRRVQPHNLVFFDDDDTPPIPCPKRTKVLNPAVGKNVGVDIRELEVVDCEEEEEEEEDWLPPPPKVMVQKQLVEDSAIKELRLKKQELVSFAKSADDVIRAVEESVKRKLDSSMPAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEccccEEEEEEEcccHHHHHHHHHHHHcccccccEEEEEccEEccccccccccccccccEEEEEEccc
ccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEccccEEEEEEEcccHHHHHHHHHHHHccccHcEEEEEEccccccccccHHHcccccccEEEEEEccc
madltevddleplfdyrrvqphnlvffddddtppipcpkrtkvlnpavgknvgvdirelevvdceeeeeeeedwlppppkvmvqKQLVEDSAIKELRLKKQELVSFAKSADDVIRAVEESVKRKLDSSMPAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKvnldqenlvfcfdgdkigpeatpaslemedndIIEVHTKKT
madltevddleplfdyRRVQPhnlvffddddtppipcpkrtkvlnpavgknvgvdirELEVVDCEEEeeeeedwlppppkvMVQKQLVEDSAIKELRLKKQELvsfaksaddvIRAVEESVkrkldssmpaaleaesekvskpaieRAKIVvsiqdkgglkqfRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPeatpaslemedndiievhtkkt
MADLTEVDDLEPLFDYRRVQPHNLVFFDDDDTPPIPCPKRTKVLNPAVGKNVGVDIRELEVVDCeeeeeeeeDWLPPPPKVMVQKQLVEDSAIKELRLKKQELVSFAKSADDVIRAVEESVKRKLDSSMPAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT
*********LEPLFDYRRVQPHNLVFFDDDDTPPIPCPKRTKVLNPAVGKNVGVDIRELEV*************************************************************************************RAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKI************************
******V**LEPLFDYRRVQPHNLVFFDDDDTP********************************EEEEEEED*****************************************************************************VVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKK*
MADLTEVDDLEPLFDYRRVQPHNLVFFDDDDTPPIPCPKRTKVLNPAVGKNVGVDIRELEVV*************PPPPKVMVQKQLVEDSAIKELRLKKQELVSFAKSADDVIRAVEES*********************KPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT
*********LEPLFDYRRVQPHNLVFFDDDDTPPIPCP*******************ELEVVDCEEEEEEEEDWLPPPPKVMVQKQLVEDSAIKELRLKKQELVSFAKSADDVIRAVEESVKRK*********************ERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTK**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADLTEVDDLEPLFDYRRVQPHNLVFFDDDDTPPIPCPKRTKVLNPAVGKNVGVDIRELEVVDCEEEEEEEEDWLPPPPKVMVQKQLVEDSAIKELRLKKQELVSFAKSADDVIRAVEESVKRKLDSSMPAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
P5585391 Small ubiquitin-related m yes no 0.324 0.791 0.424 4e-06
Q6DK7294 Small ubiquitin-related m yes no 0.315 0.744 0.394 1e-05
Q7SZ2294 Small ubiquitin-related m N/A no 0.315 0.744 0.394 1e-05
Q9Z172110 Small ubiquitin-related m yes no 0.315 0.636 0.380 2e-05
Q5XIF4110 Small ubiquitin-related m yes no 0.315 0.636 0.380 3e-05
O13351117 Ubiquitin-like protein pm yes no 0.360 0.683 0.345 3e-05
P55854103 Small ubiquitin-related m yes no 0.315 0.679 0.380 3e-05
Q17QV3104 Small ubiquitin-related m yes no 0.315 0.673 0.380 3e-05
P55852100 Small ubiquitin-related m no no 0.405 0.9 0.296 4e-05
Q5ZHQ194 Small ubiquitin-related m yes no 0.315 0.744 0.380 4e-05
>sp|P55853|SUMO_CAEEL Small ubiquitin-related modifier OS=Caenorhabditis elegans GN=smo-1 PE=1 SV=1 Back     alignment and function desciption
 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 146 ERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPA 205
           E  KI V  QD   +  FRV       +L K YAD+  +   +L F FDG +I  + TP 
Sbjct: 13  EYIKIKVVGQDSNEV-HFRVKYGTSMAKLKKSYADRTGVAVNSLRFLFDGRRINDDDTPK 71

Query: 206 SLEMEDNDIIEVH 218
           +LEMED+D+IEV+
Sbjct: 72  TLEMEDDDVIEVY 84




Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex aos-1-uba-2 and linkage to the E2 enzyme ubc-9, and can be promoted by an E3 ligase such as gei-17. Required for embryonic development, fertility, vulval morphogenesis and inhibition of vulval cell fates.
Caenorhabditis elegans (taxid: 6239)
>sp|Q6DK72|SUMO3_XENTR Small ubiquitin-related modifier 3 OS=Xenopus tropicalis GN=sumo3 PE=3 SV=1 Back     alignment and function description
>sp|Q7SZ22|SUMO3_XENLA Small ubiquitin-related modifier 3 OS=Xenopus laevis GN=sumo3 PE=3 SV=1 Back     alignment and function description
>sp|Q9Z172|SUMO3_MOUSE Small ubiquitin-related modifier 3 OS=Mus musculus GN=Sumo3 PE=2 SV=1 Back     alignment and function description
>sp|Q5XIF4|SUMO3_RAT Small ubiquitin-related modifier 3 OS=Rattus norvegicus GN=Sumo3 PE=2 SV=1 Back     alignment and function description
>sp|O13351|PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmt3 PE=1 SV=2 Back     alignment and function description
>sp|P55854|SUMO3_HUMAN Small ubiquitin-related modifier 3 OS=Homo sapiens GN=SUMO3 PE=1 SV=2 Back     alignment and function description
>sp|Q17QV3|SUMO3_BOVIN Small ubiquitin-related modifier 3 OS=Bos taurus GN=SUMO3 PE=3 SV=1 Back     alignment and function description
>sp|P55852|SUMO1_ARATH Small ubiquitin-related modifier 1 OS=Arabidopsis thaliana GN=SUMO1 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZHQ1|SUMO3_CHICK Small ubiquitin-related modifier 3 OS=Gallus gallus GN=SUMO3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
225424099218 PREDICTED: uncharacterized protein LOC10 0.945 0.963 0.618 5e-63
297737759225 unnamed protein product [Vitis vinifera] 0.945 0.933 0.618 8e-63
255570681229 conserved hypothetical protein [Ricinus 0.981 0.951 0.570 3e-55
449434584225 PREDICTED: uncharacterized protein LOC10 0.968 0.955 0.512 1e-49
388522569216 unknown [Lotus japonicus] 0.950 0.976 0.493 9e-49
18408968215 ubiquitin-related protein [Arabidopsis t 0.936 0.967 0.515 4e-47
297838571216 hypothetical protein ARALYDRAFT_475936 [ 0.932 0.958 0.506 8e-46
351727641218 uncharacterized protein LOC100500271 [Gl 0.945 0.963 0.477 2e-43
118485265216 unknown [Populus trichocarpa] 0.945 0.972 0.526 1e-41
351723003218 uncharacterized protein LOC100527121 [Gl 0.950 0.967 0.475 1e-41
>gi|225424099|ref|XP_002283125.1| PREDICTED: uncharacterized protein LOC100264466 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 136/220 (61%), Positives = 165/220 (75%), Gaps = 10/220 (4%)

Query: 7   VDDLEPLFDYRRVQPHNLVFFDDDDTPPIP--CPKRTKVLNPAVGKNVGVDIRELEVVDC 64
            ++LEPLFDY RVQP N V  DDDD+   P   PKR K+ N +  KN  V     +V+DC
Sbjct: 5   TEELEPLFDYSRVQPFNFVPLDDDDSDSSPNLTPKRKKLSNSSEEKNENV----TQVIDC 60

Query: 65  EEEEEEEEDWLPPPPK--VMVQKQLVEDSAIKELRLKKQELVSFAKSADDVIRAVEESVK 122
           +E EEE  DWLPPPPK  V VQ QL EDS +K+LRLKKQEL+ FA+SA DV+R VEES K
Sbjct: 61  KENEEE--DWLPPPPKLSVDVQNQLGEDSTLKQLRLKKQELLLFAESAKDVLRTVEESAK 118

Query: 123 RKLDSSMPAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKV 182
           R+L SS+ +++E+ + + SKP  ERAKIV+SIQDK GLKQFR+Y DDKFERLFKMYADK+
Sbjct: 119 RELGSSLQSSVESVASQPSKPPCERAKIVISIQDKDGLKQFRIYMDDKFERLFKMYADKL 178

Query: 183 NLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT 222
            LD ++L+FCFDGDKI P ATP  L MEDNDI+EVH K +
Sbjct: 179 KLDLKSLIFCFDGDKISPTATPDELGMEDNDIVEVHIKSS 218




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297737759|emb|CBI26960.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255570681|ref|XP_002526295.1| conserved hypothetical protein [Ricinus communis] gi|223534376|gb|EEF36084.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449434584|ref|XP_004135076.1| PREDICTED: uncharacterized protein LOC101214853 [Cucumis sativus] Back     alignment and taxonomy information
>gi|388522569|gb|AFK49346.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|18408968|ref|NP_564924.1| ubiquitin-related protein [Arabidopsis thaliana] gi|21554742|gb|AAM63677.1| unknown [Arabidopsis thaliana] gi|88193818|gb|ABD42998.1| At1g68185 [Arabidopsis thaliana] gi|332196640|gb|AEE34761.1| ubiquitin-related protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297838571|ref|XP_002887167.1| hypothetical protein ARALYDRAFT_475936 [Arabidopsis lyrata subsp. lyrata] gi|297333008|gb|EFH63426.1| hypothetical protein ARALYDRAFT_475936 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|351727641|ref|NP_001235632.1| uncharacterized protein LOC100500271 [Glycine max] gi|255629887|gb|ACU15294.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|118485265|gb|ABK94492.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351723003|ref|NP_001235216.1| uncharacterized protein LOC100527121 [Glycine max] gi|255631604|gb|ACU16169.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
TAIR|locus:505006207215 AT1G68185 "AT1G68185" [Arabido 0.936 0.967 0.524 1.5e-51
WB|WBGene0000488891 smo-1 [Caenorhabditis elegans 0.337 0.824 0.407 1.4e-08
UNIPROTKB|P5585391 smo-1 "Small ubiquitin-related 0.337 0.824 0.407 1.4e-08
ZFIN|ZDB-GENE-120215-15594 sumo2a "SMT3 suppressor of mif 0.292 0.691 0.439 2.4e-08
UNIPROTKB|F1M2K394 F1M2K3 "Uncharacterized protei 0.405 0.957 0.340 3.2e-08
UNIPROTKB|J9P2X4133 LOC100856530 "Uncharacterized 0.423 0.706 0.326 4.2e-08
UNIPROTKB|Q5ZJM995 SUMO2 "Small ubiquitin-related 0.396 0.926 0.337 5.5e-08
UNIPROTKB|G5E5Y595 SUMO2 "Small ubiquitin-related 0.405 0.947 0.340 5.5e-08
UNIPROTKB|P6195595 SUMO2 "Small ubiquitin-related 0.396 0.926 0.337 5.5e-08
UNIPROTKB|E2RGN595 SUMO2 "Uncharacterized protein 0.396 0.926 0.337 5.5e-08
TAIR|locus:505006207 AT1G68185 "AT1G68185" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 535 (193.4 bits), Expect = 1.5e-51, P = 1.5e-51
 Identities = 116/221 (52%), Positives = 146/221 (66%)

Query:     6 EVDDLEPLFDYRRVQPHNLVFFDDDDTPP--IPCPKRTKVLNPAVGKNVGVDIRELEVVD 63
             E +DLEPLFDYRRVQP N V  DDDD      P PK+ K  +  V K +  D++ +EV  
Sbjct:     4 EGEDLEPLFDYRRVQPANFVCIDDDDDDASVTPIPKKAKT-SQTVEK-LDDDVKVIEVTG 61

Query:    64 CXXXXXXXXDWLPPPPKVMVQKQL--VEDSAIKELRLKKQELVSFAKSADDVIRAVEESV 121
                      DWL PPPKV+  K    VEDS IK LR KK EL+SF K+  DV++ VEES 
Sbjct:    62 -------DDDWLLPPPKVIFDKSKDSVEDSTIKALRSKKMELMSFTKTVGDVMQEVEESA 114

Query:   122 KRKLDSSMPAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADK 181
             KR+++ S   + E  ++  S+P  +RAKIV++IQDK G K  RV+AD+KFER+ K+Y DK
Sbjct:   115 KREVEESRNPSSETAAQLPSEPTNDRAKIVITIQDKDGQKTLRVFADEKFERVIKLYTDK 174

Query:   182 VNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT 222
               LD +NLVF FDGDKI P  TP+ L MED+D+IEVHTKKT
Sbjct:   175 AKLDPQNLVFIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215




GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
WB|WBGene00004888 smo-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P55853 smo-1 "Small ubiquitin-related modifier" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120215-155 sumo2a "SMT3 suppressor of mif two 3 homolog 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1M2K3 F1M2K3 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2X4 LOC100856530 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJM9 SUMO2 "Small ubiquitin-related modifier 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G5E5Y5 SUMO2 "Small ubiquitin-related modifier 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P61955 SUMO2 "Small ubiquitin-related modifier 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGN5 SUMO2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
cd0176387 cd01763, Sumo, Small ubiquitin-related modifier (S 2e-13
pfam1197672 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO- 2e-10
COG5227103 COG5227, SMT3, Ubiquitin-like protein (sentrin) [P 7e-09
>gnl|CDD|176359 cd01763, Sumo, Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
 Score = 63.0 bits (154), Expect = 2e-13
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 148 AKIVVSIQDKGGLK-QFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPAS 206
             I + ++ + G +  F++      ++L + Y  +  L   ++ F FDG +I    TP  
Sbjct: 10  EHINLKVKGQDGNEVFFKIKRSTPLKKLMEAYCQRQGLSMNSVRFLFDGQRIRDNQTPDD 69

Query: 207 LEMEDNDIIEVHTKKT 222
           L MED D IEV  ++T
Sbjct: 70  LGMEDGDEIEVMLEQT 85


Small ubiquitin-related modifier (SUMO) proteins are conjugated to numerous intracellular targets and serve to modulate protein interaction, localization, activity or stability. SUMO (also known as "Smt3" and "sentrin" in other organisms) is linked to several different pathways, including nucleocytoplasmic transport. Attachment of SUMO to targets proteins is stimulated by PIAS (Protein inhibitor of activated STATs) proteins which serve as E3-like ligases. Length = 87

>gnl|CDD|192903 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO-like Back     alignment and domain information
>gnl|CDD|227552 COG5227, SMT3, Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 99.93
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 99.86
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.84
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 99.81
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 98.93
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 98.65
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 98.63
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 98.57
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 98.48
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 98.46
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 98.43
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 98.43
PTZ0004476 ubiquitin; Provisional 98.35
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 98.28
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 98.27
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 98.23
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 98.23
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 98.23
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 98.22
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 98.22
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 98.12
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 98.07
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 98.05
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 98.0
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 97.86
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 97.81
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 97.6
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 97.54
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 97.52
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 97.51
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 97.49
KOG0010 493 consensus Ubiquitin-like protein [Posttranslationa 97.08
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 96.81
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 96.61
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 96.46
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 96.39
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 96.36
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 95.32
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 95.28
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 95.1
PLN02560 308 enoyl-CoA reductase 95.1
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 94.79
PRK0836470 sulfur carrier protein ThiS; Provisional 94.18
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 93.52
KOG0011 340 consensus Nucleotide excision repair factor NEF2, 93.14
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 92.94
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 92.84
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 90.89
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 90.7
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 90.31
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 89.82
cd0599281 PB1 The PB1 domain is a modular domain mediating s 88.39
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 86.44
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 86.28
PF0367176 Ufm1: Ubiquitin fold modifier 1 protein; InterPro: 86.23
PRK0643767 hypothetical protein; Provisional 85.87
cd0639681 PB1_NBR1 The PB1 domain is an essential part of NB 85.49
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 85.18
KOG0006 446 consensus E3 ubiquitin-protein ligase (Parkin prot 84.94
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 84.58
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 84.46
PF12436249 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-sp 83.69
cd0176682 Ufm1 Urm1-like ubiquitin domain. Ufm1 (ubiquitin-f 83.19
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 82.71
PRK0744070 hypothetical protein; Provisional 81.7
smart0016680 UBX Domain present in ubiquitin-regulatory protein 81.33
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 80.27
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.93  E-value=8.3e-26  Score=176.46  Aligned_cols=76  Identities=34%  Similarity=0.590  Sum_probs=73.5

Q ss_pred             CCcEEEEEEeCCce-EEEEEcCCChHHHHHHHHHHHcCCCCCceEEEECCcccCCCCCcccCCCCCCcEEEEEeccC
Q 027537          147 RAKIVVSIQDKGGL-KQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT  222 (222)
Q Consensus       147 ~~kItIkV~~qdg~-v~FkIk~tT~L~KLf~aYaer~gl~~~~lrF~FDG~rI~~~~TP~sLgMEDGDiIDV~ikQ~  222 (222)
                      ..+|+|+|.++++. ++|+|+++|+|.|||++||++.|++.++|||+|||+||..++||++|+|||||+|+|+..|.
T Consensus        18 ~~hi~LKV~gqd~~~~~Fkikr~t~LkKLM~aYc~r~Gl~~~s~RFlFdG~rI~~~~TP~~L~mEd~D~Iev~~~q~   94 (99)
T KOG1769|consen   18 SEHINLKVKGQDGSVVVFKIKRHTPLKKLMKAYCERQGLSMNSLRFLFDGQRIRETHTPADLEMEDGDEIEVVQEQT   94 (99)
T ss_pred             cceEEEEEecCCCCEEEEEeecCChHHHHHHHHHHHcCCccceEEEEECCcCcCCCCChhhhCCcCCcEEEEEeecc
Confidence            68999999998886 79999999999999999999999999999999999999999999999999999999999884



>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>PF03671 Ufm1: Ubiquitin fold modifier 1 protein; InterPro: IPR005375 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>PF12436 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-specific protease 7; InterPro: IPR024729 This domain is found in eukaryotes, and is approximately 40 amino acids in length Back     alignment and domain information
>cd01766 Ufm1 Urm1-like ubiquitin domain Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
1u4a_A87 Solution Structure Of Human Sumo-3 C47s Length = 87 3e-06
2k1f_A88 Sumo-3 From Drosophila Melanogaster (Dsmt3) Length 3e-06
1wz0_A104 Solution Structure Of Human Sumo-2 (Smt3b), A Ubiqu 3e-06
2awt_A95 Solution Structure Of Human Small Ubiquitin-Like Mo 3e-06
2d07_B93 Crystal Structure Of Sumo-3-Modified Thymine-Dna Gl 3e-06
2io3_B81 Crystal Structure Of Human Senp2 In Complex With Ra 4e-06
2io0_B91 Crystal Structure Of Human Senp2 In Complex With Pr 4e-06
2ckh_B79 Senp1-sumo2 Complex Length = 79 4e-06
2io1_B94 Crystal Structure Of Human Senp2 In Complex With Pr 4e-06
2iyd_B81 Senp1 Covalent Complex With Sumo-2 Length = 81 5e-06
3uin_B80 Complex Between Human Rangap1-Sumo2, Ubc9 And The I 5e-06
3tix_A207 Crystal Structure Of The Chp1-Tas3 Complex Core Len 8e-06
2eke_C106 Structure Of A Sumo-Binding-Motif Mimic Bound To Sm 1e-05
3qht_A98 Crystal Structure Of The Monobody Ysmb-1 Bound To Y 1e-05
1wm3_A72 Crystal Structure Of Human Sumo-2 Protein Length = 1e-05
1l2n_A101 Smt3 Solution Structure Length = 101 1e-05
1euv_B86 X-Ray Structure Of The C-Terminal Ulp1 Protease Dom 1e-05
3v7o_A 227 Crystal Structure Of The C-Terminal Domain Of Ebola 1e-05
1wm2_A78 Crystal Structure Of Human Sumo-2 Protein Length = 1e-05
3uqb_A 209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-05
3uf8_A 209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-05
3uqa_A 209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-05
4ggq_C 209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-05
3vaw_A 209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-05
3v62_A84 Structure Of The S. Cerevisiae Srs2 C-Terminal Doma 2e-05
3v60_A84 Structure Of S. Cerevisiae Pcna Conjugated To Sumo 2e-05
3pge_A200 Structure Of Sumoylated Pcna Length = 200 2e-05
3ix6_A 360 Crystal Structure Of Thymidylate Synthase Thya From 3e-05
4da1_A 389 Crystal Structure Of Branched-Chain Alpha-Ketoacid 9e-05
3rzw_C99 Crystal Structure Of The Monobody Ysmb-9 Bound To H 2e-04
2uyz_B79 Non-Covalent Complex Between Ubc9 And Sumo1 Length 5e-04
2iy0_B82 Senp1 (Mutant) Sumo1 Rangap Length = 82 7e-04
1a5r_A103 Structure Determination Of The Small Ubiquitin-Rela 7e-04
1y8r_C97 Sumo E1 Activating Enzyme Sae1-Sae2-Sumo1-Mg-Atp Co 7e-04
2g4d_B78 Crystal Structure Of Human Senp1 Mutant (C603s) In 7e-04
2kqs_A99 Phosphorylation Of Sumo-Interacting Motif By Ck2 En 7e-04
2bf8_B77 Crystal Structure Of Sumo Modified Ubiquitin Conjug 7e-04
2iy1_B83 Senp1 (Mutant) Full Length Sumo1 Length = 83 7e-04
1z5s_B82 Crystal Structure Of A Complex Between Ubc9, Sumo-1 8e-04
1tgz_B80 Structure Of Human Senp2 In Complex With Sumo-1 Len 8e-04
>pdb|1U4A|A Chain A, Solution Structure Of Human Sumo-3 C47s Length = 87 Back     alignment and structure

Iteration: 1

Score = 48.5 bits (114), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Query: 152 VSIQDKGGLKQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEMED 211 V+ QD G + QF++ +L K Y+++ L + F FDG I TPA LEMED Sbjct: 8 VAGQD-GSVVQFKIKRHTPLSKLMKAYSERQGLSMRQIRFRFDGQPINETDTPAQLEMED 66 Query: 212 NDIIEVHTKKT 222 D I+V ++T Sbjct: 67 EDTIDVFQQQT 77
>pdb|2K1F|A Chain A, Sumo-3 From Drosophila Melanogaster (Dsmt3) Length = 88 Back     alignment and structure
>pdb|1WZ0|A Chain A, Solution Structure Of Human Sumo-2 (Smt3b), A Ubiquitin- Like Protein Length = 104 Back     alignment and structure
>pdb|2AWT|A Chain A, Solution Structure Of Human Small Ubiquitin-Like Modifier Protein Isoform 2 (Sumo-2) Length = 95 Back     alignment and structure
>pdb|2D07|B Chain B, Crystal Structure Of Sumo-3-Modified Thymine-Dna Glycosylase Length = 93 Back     alignment and structure
>pdb|2IO3|B Chain B, Crystal Structure Of Human Senp2 In Complex With Rangap1- Sumo-2 Length = 81 Back     alignment and structure
>pdb|2IO0|B Chain B, Crystal Structure Of Human Senp2 In Complex With Presumo-2 Length = 91 Back     alignment and structure
>pdb|2CKH|B Chain B, Senp1-sumo2 Complex Length = 79 Back     alignment and structure
>pdb|2IO1|B Chain B, Crystal Structure Of Human Senp2 In Complex With Presumo-3 Length = 94 Back     alignment and structure
>pdb|2IYD|B Chain B, Senp1 Covalent Complex With Sumo-2 Length = 81 Back     alignment and structure
>pdb|3UIN|B Chain B, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Length = 80 Back     alignment and structure
>pdb|3TIX|A Chain A, Crystal Structure Of The Chp1-Tas3 Complex Core Length = 207 Back     alignment and structure
>pdb|2EKE|C Chain C, Structure Of A Sumo-Binding-Motif Mimic Bound To Smt3p- Ubc9p: Conservation Of A Noncovalent Ubiquitin-Like Protein-E2 Complex As A Platform For Selective Interactions Within A Sumo Pathway Length = 106 Back     alignment and structure
>pdb|3QHT|A Chain A, Crystal Structure Of The Monobody Ysmb-1 Bound To Yeast Sumo Length = 98 Back     alignment and structure
>pdb|1WM3|A Chain A, Crystal Structure Of Human Sumo-2 Protein Length = 72 Back     alignment and structure
>pdb|1L2N|A Chain A, Smt3 Solution Structure Length = 101 Back     alignment and structure
>pdb|1EUV|B Chain B, X-Ray Structure Of The C-Terminal Ulp1 Protease Domain In Complex With Smt3, The Yeast Ortholog Of Sumo Length = 86 Back     alignment and structure
>pdb|3V7O|A Chain A, Crystal Structure Of The C-Terminal Domain Of Ebola Virus Vp30 (Strain Reston-89) Length = 227 Back     alignment and structure
>pdb|1WM2|A Chain A, Crystal Structure Of Human Sumo-2 Protein Length = 78 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3V62|A Chain A, Structure Of The S. Cerevisiae Srs2 C-Terminal Domain In Complex With Pcna Conjugated To Sumo On Lysine 164 Length = 84 Back     alignment and structure
>pdb|3V60|A Chain A, Structure Of S. Cerevisiae Pcna Conjugated To Sumo On Lysine 164 Length = 84 Back     alignment and structure
>pdb|3PGE|A Chain A, Structure Of Sumoylated Pcna Length = 200 Back     alignment and structure
>pdb|3IX6|A Chain A, Crystal Structure Of Thymidylate Synthase Thya From Brucella Melitensis Length = 360 Back     alignment and structure
>pdb|4DA1|A Chain A, Crystal Structure Of Branched-Chain Alpha-Ketoacid Dehydrogenase Phosphatase With Mg (Ii) Ions At The Active Site Length = 389 Back     alignment and structure
>pdb|3RZW|C Chain C, Crystal Structure Of The Monobody Ysmb-9 Bound To Human Sumo1 Length = 99 Back     alignment and structure
>pdb|2UYZ|B Chain B, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 79 Back     alignment and structure
>pdb|2IY0|B Chain B, Senp1 (Mutant) Sumo1 Rangap Length = 82 Back     alignment and structure
>pdb|1A5R|A Chain A, Structure Determination Of The Small Ubiquitin-Related Modifier Sumo-1, Nmr, 10 Structures Length = 103 Back     alignment and structure
>pdb|1Y8R|C Chain C, Sumo E1 Activating Enzyme Sae1-Sae2-Sumo1-Mg-Atp Complex Length = 97 Back     alignment and structure
>pdb|2G4D|B Chain B, Crystal Structure Of Human Senp1 Mutant (C603s) In Complex With Sumo-1 Length = 78 Back     alignment and structure
>pdb|2KQS|A Chain A, Phosphorylation Of Sumo-Interacting Motif By Ck2 Enhances Daxx Sumo Binding Activity Length = 99 Back     alignment and structure
>pdb|2BF8|B Chain B, Crystal Structure Of Sumo Modified Ubiquitin Conjugating Enzyme E2-25k Length = 77 Back     alignment and structure
>pdb|2IY1|B Chain B, Senp1 (Mutant) Full Length Sumo1 Length = 83 Back     alignment and structure
>pdb|1Z5S|B Chain B, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 82 Back     alignment and structure
>pdb|1TGZ|B Chain B, Structure Of Human Senp2 In Complex With Sumo-1 Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 9e-20
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 2e-19
3v7o_A 227 Minor nucleoprotein VP30; ssgcid, seattle structur 4e-19
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 4e-19
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 4e-19
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 1e-18
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 2e-18
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 3e-18
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 3e-18
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 4e-18
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 4e-18
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 5e-18
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 2e-17
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 2e-17
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 1e-10
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 5e-09
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
 Score = 80.0 bits (197), Expect = 9e-20
 Identities = 25/97 (25%), Positives = 42/97 (43%)

Query: 126 DSSMPAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLD 185
                  L     +V         I + + D      F++       RL + +A +   +
Sbjct: 8   HHHSQDPLVPRGSEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKE 67

Query: 186 QENLVFCFDGDKIGPEATPASLEMEDNDIIEVHTKKT 222
            ++L F +DG +I  + TP  L+MEDNDIIE H ++ 
Sbjct: 68  MDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQI 104


>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Length = 91 Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Length = 227 Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Length = 207 Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Length = 94 Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 104 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} Length = 115 Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Length = 79 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Length = 79 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Length = 97 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Length = 110 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Length = 93 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Length = 72 Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Length = 200 Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Length = 82 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 99.94
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 99.92
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 99.91
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.89
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.89
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.89
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.89
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 99.89
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.88
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 99.88
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.88
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 99.87
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 99.87
3v7o_A 227 Minor nucleoprotein VP30; ssgcid, seattle structur 99.83
3uf8_A 209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.82
4da1_A 389 Protein phosphatase 1K, mitochondrial; metal-ION-a 99.79
3ix6_A 360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 99.77
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 99.76
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.47
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.42
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 98.89
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 98.85
3v6c_B91 Ubiquitin; structural genomics, structural genomic 98.85
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 98.8
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 98.79
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 98.79
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 98.77
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 98.77
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 98.76
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 98.76
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 98.75
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 98.75
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 98.72
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 98.7
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 98.68
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 98.63
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 98.62
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 98.61
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 98.6
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 98.6
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 98.59
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 98.55
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 98.55
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 98.55
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 98.54
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 98.53
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 98.52
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 98.51
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 98.47
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 98.46
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 98.46
3m62_B106 UV excision repair protein RAD23; armadillo-like r 98.43
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 98.4
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 98.4
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 98.39
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 98.36
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 98.31
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 98.28
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 98.26
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 98.25
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 97.57
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 98.24
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 98.24
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 98.23
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 98.22
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 98.2
1we6_A111 Splicing factor, putative; structural genomics, ub 98.18
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 98.17
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 98.16
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 98.16
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 98.13
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 98.1
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 98.06
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 98.04
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 98.02
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 98.01
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 98.0
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 98.0
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 97.94
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 97.92
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 97.86
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 97.85
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 97.79
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 97.77
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 97.77
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 97.76
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 97.73
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 97.73
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 97.69
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 97.67
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 97.66
2kj6_A97 Tubulin folding cofactor B; methods development, N 97.58
2fnj_B118 Transcription elongation factor B polypeptide 2; b 97.53
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 97.51
4ajy_B118 Transcription elongation factor B polypeptide 2; E 97.48
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 97.47
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 97.45
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 97.4
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 97.37
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 97.33
2pjh_A80 Protein NPL4, nuclear protein localization protein 97.1
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 97.03
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 96.98
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 96.95
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 96.81
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 96.11
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 96.09
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 95.85
2xzm_9 189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 95.0
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 94.33
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 92.1
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 91.75
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 91.7
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 90.06
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 89.64
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 89.28
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 88.08
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 87.59
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 86.57
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 86.43
1j0g_A92 Hypothetical protein 1810045K17; ubiquitin-like fo 86.17
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 85.66
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 82.58
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 81.08
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.94  E-value=2.6e-27  Score=182.92  Aligned_cols=91  Identities=14%  Similarity=0.280  Sum_probs=80.7

Q ss_pred             chhhhhhhccCCCCcCCCCcEEEEEEeCCceEEEEEcCCChHHHHHHHHHHHcCCCCCceEEEECCcccCCCCCcccCCC
Q 027537          130 PAALEAESEKVSKPAIERAKIVVSIQDKGGLKQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEM  209 (222)
Q Consensus       130 ~~e~~~~~~~~~~p~~~~~kItIkV~~qdg~v~FkIk~tT~L~KLf~aYaer~gl~~~~lrF~FDG~rI~~~~TP~sLgM  209 (222)
                      .++++++++++. |. .+.+|+|+|++.+++++|+||++|+|+|||++||++.|++++++||+|||.||++++||++|||
T Consensus         4 ~~~~~~~~~~~~-~~-~~~~IniKV~~~g~ev~FkIK~tt~l~KL~~aYc~r~gv~~~sirFlfDG~rI~~~~TP~~L~m   81 (95)
T 2l76_A            4 EDEVVLVEGPTL-PE-TPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKL   81 (95)
T ss_dssp             CCCCCSSSCCCC-CS-CCCCEEEEEECSSSEEEEEECSSSCTHHHHHHHHHHHTSCGGGEEEEETTEECCTTSCHHHHTC
T ss_pred             cccEEEecCCCC-CC-CCCeEEEEEEcCCcEEEEEEecCChHHHHHHHHHhhcCCChhhEEEEECCcCCCCCCCHhHcCC
Confidence            456666666654 43 5788999999776679999999999999999999999999999999999999999999999999


Q ss_pred             CCCcEEEEEeccC
Q 027537          210 EDNDIIEVHTKKT  222 (222)
Q Consensus       210 EDGDiIDV~ikQ~  222 (222)
                      ||||+|||++-.|
T Consensus        82 eD~DiID~~~~~~   94 (95)
T 2l76_A           82 GVADIIDCVVLTS   94 (95)
T ss_dssp             CSSCEEEEEECCC
T ss_pred             CCCCEEEEEEecC
Confidence            9999999998654



>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>1j0g_A Hypothetical protein 1810045K17; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.6 PDB: 1wxs_A 1l7y_A Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d1wm3a_72 d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 3e-17
d2uyzb177 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human 4e-14
d1euvb_79 d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea 7e-13
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: SUMO-2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 71.3 bits (175), Expect = 3e-17
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 150 IVVSIQDKGGLK-QFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLE 208
           I + +  + G   QF++       +L K Y ++  L    + F FDG  I    TPA LE
Sbjct: 2   INLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLE 61

Query: 209 MEDNDIIEVH 218
           MED D I+V 
Sbjct: 62  MEDEDTIDVF 71


>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.89
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.86
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 98.83
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 98.73
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 98.71
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 98.71
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.69
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 98.63
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 98.63
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 98.6
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 98.58
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 98.57
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 98.55
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 98.5
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 98.5
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 98.5
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 98.4
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 98.39
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 98.3
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 98.3
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 98.27
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 98.23
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 98.17
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 98.17
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 98.13
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 98.12
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 98.05
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 98.03
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 98.01
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 97.99
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 97.98
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 97.91
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 97.65
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 97.37
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 97.27
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 97.12
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 96.91
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 96.05
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 94.94
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 93.04
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.5
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 88.36
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 85.74
d1y8xb192 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 84.58
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 80.46
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: SUMO-2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=6.5e-25  Score=158.06  Aligned_cols=71  Identities=34%  Similarity=0.611  Sum_probs=68.8

Q ss_pred             cEEEEEEeCCce-EEEEEcCCChHHHHHHHHHHHcCCCCCceEEEECCcccCCCCCcccCCCCCCcEEEEEe
Q 027537          149 KIVVSIQDKGGL-KQFRVYADDKFERLFKMYADKVNLDQENLVFCFDGDKIGPEATPASLEMEDNDIIEVHT  219 (222)
Q Consensus       149 kItIkV~~qdg~-v~FkIk~tT~L~KLf~aYaer~gl~~~~lrF~FDG~rI~~~~TP~sLgMEDGDiIDV~i  219 (222)
                      ||+|+|++++|. ++|+|+++++|++||++||++.|++++.++|+|||++|.+++||++|||||||+|+||.
T Consensus         1 ~I~lkv~~~~g~~v~f~vk~~t~l~kl~~~y~~~~~~~~~~~~f~fdG~~i~~~~Tp~~l~med~D~Idv~~   72 (72)
T d1wm3a_           1 HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQ   72 (72)
T ss_dssp             CEEEEEECTTSCEEEEEECTTSCTHHHHHHHHHHHTCCTTTCEEEETTEECCTTCCTTTTTCCTTEEEEEEC
T ss_pred             CEEEEEECCCCCEEEEEEcCCChHHHHHHHHHHHhCCCccceEEEECCEEcCCCCCHHHcCCCCCCEEEEEC
Confidence            699999999986 89999999999999999999999999999999999999999999999999999999984



>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure