BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 027546
(222 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2WMC|A Chain A, Crystal Structure Of Eukaryotic Initiation Factor 4e From
Pisum Sativum
pdb|2WMC|B Chain B, Crystal Structure Of Eukaryotic Initiation Factor 4e From
Pisum Sativum
pdb|2WMC|C Chain C, Crystal Structure Of Eukaryotic Initiation Factor 4e From
Pisum Sativum
pdb|2WMC|D Chain D, Crystal Structure Of Eukaryotic Initiation Factor 4e From
Pisum Sativum
pdb|2WMC|E Chain E, Crystal Structure Of Eukaryotic Initiation Factor 4e From
Pisum Sativum
pdb|2WMC|F Chain F, Crystal Structure Of Eukaryotic Initiation Factor 4e From
Pisum Sativum
pdb|2WMC|G Chain G, Crystal Structure Of Eukaryotic Initiation Factor 4e From
Pisum Sativum
pdb|2WMC|H Chain H, Crystal Structure Of Eukaryotic Initiation Factor 4e From
Pisum Sativum
Length = 178
Score = 28.1 bits (61), Expect = 3.5, Method: Compositional matrix adjust.
Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 8/52 (15%)
Query: 17 NVSAQREAVESWRREKLEEAKQLSIGRQ-----GINST---ILQEEARMLVR 60
NV + E + W + EA Q+SIG+Q N T I ++AR L R
Sbjct: 119 NVRGRAEKISIWTKNASNEAAQVSIGKQWKEFLDYNETMGFIFHDDARKLDR 170
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.133 0.429
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,082,207
Number of Sequences: 62578
Number of extensions: 275701
Number of successful extensions: 583
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 582
Number of HSP's gapped (non-prelim): 2
length of query: 222
length of database: 14,973,337
effective HSP length: 95
effective length of query: 127
effective length of database: 9,028,427
effective search space: 1146610229
effective search space used: 1146610229
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)