Citrus Sinensis ID: 027617


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
MSDVFERYERQYCEISANLSKKCTAAASLDGERKKQKVSEIQTGLDEAESLIRKMDLEARSLQPNVKAVLLAKLREYKSDLNNLKSEVKRLVSGNLNAAARDELLESGMADALTASADQRSRLMMSTERVNQSTDRIKDSRRTMLETEELGVSILQDLSSQRQSLLHAHNTLHGVDDNVSKSKKVLTAMSRRMSRNKWIIGTVVAVLVIAIILILYFKLAK
ccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MSDVFERYERQYCEISAN**************************LDEAESLIRK**********NVKAVLLAKLREYKSDLNNLKSE***********************************************************TEELGVSILQ**************T*HGVDDNVSKSKKVLTAMSRRMSRNKWIIGTVVAVLVIAIILILYFKLAK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDVFERYERQYCEISANLSKKCTAAASLDGERKKQKVSEIQTGLDEAESLIRKMDLEARSLQPNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxNLNAAARDELLESGMADALTASADQRSRLMMSTERVNQSTDRIKDSRRTMLETEELGVSILQDLSSQRQSLLHAHNTLHGVDDNVSKSKKVLTAMSRRMSRNKWIIGTVVAVLVIAIILILYFKLAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle transport v-SNARE 11 May function as a v-SNARE responsible for targeting AtELP-containing vesicles from the trans-Golgi network (TGN) to the prevacuolar compartment (PVC). May be also involved in retrograde traffic to the cis-Golgi.confidentQ9SEL6
Vesicle transport v-SNARE 13 May function as a v-SNARE responsible for targeting vesicles involved in the secretory pathway.confidentQ9LVP9
Vesicle transport through interaction with t-SNAREs homolog 1A V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. Involved in vesicular transport from the late endosomes to the trans-Golgi network. Along with VAMP7, involved in an non-conventional RAB1-dependent traffic route to the cell surface used by KCNIP1 and KCND2. May be concerned with increased secretion of cytokines associated with cellular senescence.probableO89116

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VCS, chain A
Confidence level:very confident
Coverage over the Query: 1-94
View the alignment between query and template
View the model in PyMOL
Template: 2NPS, chain C
Confidence level:confident
Coverage over the Query: 118-195
View the alignment between query and template
View the model in PyMOL