Citrus Sinensis ID: 027625


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
MSQVFEGYERQYCELSAGLSRKCTAASALDGELKKQKLSEIKTGLDDADALIRKMDLEARSLQPNVKAMLLSKLREYKTDLNNLKNEVKRVTSGNVNQAARDELLESGMADAMMVSADQRGRLLMSTERLNHSTDRIKESRRTMLETEELGVSILQDLHQQRQSLLHAHNTLHGVDDNISKSKKILTAMSRRMSRDKWIMGSIISVLVFAILLILYFKLTR
ccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MSQVFEGYERQYCELSAGLSRKCT********************LDDADALIRKMD***********AMLLSKLREYKTDLNNLKNEVKR******************************************************LETEELGVSILQDLHQ****LLHAHNTLHGVDDNISKSKKILTAMSRRMSRDKWIMGSIISVLVFAILLILYFKLTR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQVFEGYERQYCELSAGLSRKCTAASALDGELKKQKLSEIKTGLDDADALIRKMDLEARSLQPNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxNVNQAARDELLESGMADAMMVSADQRGRLLMSTERLNHSTDRIKESRRTMLETEELGVSILQDLHQQRQSLLHAHNTLHGVDDNISKSKKILTAMSRRMSRDKWIMGSIISVLVFAILLILYFKLTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle transport v-SNARE 12 May function as a v-SNARE responsible for the docking or fusion of transport vesicles within the trans-Golgi network (TGN). May be also involved in retrograde traffic to the cis-Golgi.confidentQ9SEL5
Vesicle transport v-SNARE 13 May function as a v-SNARE responsible for targeting vesicles involved in the secretory pathway.confidentQ9LVP9
Vesicle transport through interaction with t-SNAREs homolog 1B V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. May be concerned with increased secretion of cytokines associated with cellular senescence.probableQ2KIU0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VCS, chain A
Confidence level:very confident
Coverage over the Query: 1-94
View the alignment between query and template
View the model in PyMOL
Template: 2NPS, chain C
Confidence level:very confident
Coverage over the Query: 119-195
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3vkg, chain A probable Alignment | Template Structure