BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027638
         (221 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3EQ1|A Chain A, The Crystal Structure Of Human Porphobilinogen Deaminase
           At 2.8a Resolution
 pdb|3EQ1|B Chain B, The Crystal Structure Of Human Porphobilinogen Deaminase
           At 2.8a Resolution
          Length = 361

 Score = 27.7 bits (60), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 9/73 (12%)

Query: 9   IGTSSFGASAHYTHRFSKKSHGRIQGRLGSTALELEVGGGRKISEFSTIRMLYSVGIQGI 68
           +GTSS   +A    +F       IQG L +   +L+     +  EFS I +L + G+Q +
Sbjct: 143 VGTSSLRRAAQLQRKFPHLEFRSIQGNLNTRLRKLD-----EQQEFSAI-ILATAGLQRM 196

Query: 69  FWKFELHRAGQKL 81
            W    +R GQ L
Sbjct: 197 GWH---NRVGQIL 206


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,285,578
Number of Sequences: 62578
Number of extensions: 177222
Number of successful extensions: 347
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 347
Number of HSP's gapped (non-prelim): 1
length of query: 221
length of database: 14,973,337
effective HSP length: 95
effective length of query: 126
effective length of database: 9,028,427
effective search space: 1137581802
effective search space used: 1137581802
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)