Citrus Sinensis ID: 027667


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVAVIIFSPRGKLSEFASSSMQETIERYLKHTKDTRNKQQPTEQNMQHLKHEAANMVKKIELLEVSKRKLLGEGLASCTLEELQQIERQLEKSVSNIRARKNQVFNEQIAQLKEKGKVLEAENTRLEEKCGMENWQGSKEQPENLTNDDGASTSDVETELFIGPPPERRARRLAIPPQN
cccccccHHccccccccccccccccccccHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHcHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccc
*****TQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVAVIIFSPRGKLSEFASSSMQETIERYLK******************LKHEAANMVKKIELLEVSKRKLLGEGLASCTLEELQQIERQLEKSVSNIRARKNQVFNEQIAQLKEKGKVLEAENTRLE****************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVAVIIFSPRGKLSEFASSSMQETIERYLKHTKDTRNKQQPTEQNxxxxxxxxxxxxxxxxxxxxxKRKLLGEGLASCTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCGMENWQGSKEQPENLTNDDGASTSDVETELFIGPPPERRARRLAIPPQN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MADS-box transcription factor 50 Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway.probableQ9XJ60
MADS-box protein SOC1 Transcription activator active in flowering time control. May integrate signals from the photoperiod, vernalization and autonomous floral induction pathways. Can modulates class B and C homeotic genes expression. When associated with AGL24, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development.probableO64645

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EGW, chain A
Confidence level:very confident
Coverage over the Query: 2-72
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 119-166
View the alignment between query and template
View the model in PyMOL