BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027686
         (220 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4E2Q|A Chain A, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|B Chain B, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|C Chain C, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|D Chain D, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|E Chain E, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|F Chain F, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|G Chain G, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|H Chain H, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|I Chain I, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|J Chain J, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|K Chain K, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|L Chain L, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|M Chain M, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|N Chain N, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|O Chain O, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2Q|P Chain P, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana
 pdb|4E2S|A Chain A, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|B Chain B, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|C Chain C, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|D Chain D, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|E Chain E, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|F Chain F, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|G Chain G, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|H Chain H, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|I Chain I, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|J Chain J, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|K Chain K, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|L Chain L, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|M Chain M, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|N Chain N, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|O Chain O, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
 pdb|4E2S|P Chain P, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
           Arabidopsis Thaliana In Complex With Its Substrate,
           (S)-Ureidoglycine
          Length = 266

 Score = 31.6 bits (70), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 68/166 (40%), Gaps = 23/166 (13%)

Query: 35  VIEMVSGSLLRSNRSSYAPLSTEDPGPSSSDAFSVGLPPAWVD--DAEEIANLSSFGDGK 92
           +I +V G++  +N SS +   T D     S A+   LPP +    D  E A L  F    
Sbjct: 93  LIFVVEGAVTLTNTSSSSKKLTVD-----SYAY---LPPNFHHSLDCVESATLVVF---- 140

Query: 93  QDQHMIEILTYEITDLLRGSEKRLDKLSAAGSSEDSNLRKNVQHSLATDLQNHSMDLRKN 152
             +   E L    T+L+ GS  +   L   G  E   LRK +  S+A D   H+MD +  
Sbjct: 141 --ERRYEYLGSHTTELIVGSTDKQPLLETPG--EVFELRKLLPMSVAYDFNIHTMDFQPG 196

Query: 153 HSTYLKHLQQQKEGCDGVDLEMNFNEDKYRLEDDGFSDGGFDAHQM 198
               +K +   + G   ++      +  YRL D+ +     D   M
Sbjct: 197 EFLNVKEVHYNQHGLLLLE-----GQGIYRLGDNWYPVQAGDVIWM 237


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.129    0.365 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,092,226
Number of Sequences: 62578
Number of extensions: 235997
Number of successful extensions: 330
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 330
Number of HSP's gapped (non-prelim): 5
length of query: 220
length of database: 14,973,337
effective HSP length: 95
effective length of query: 125
effective length of database: 9,028,427
effective search space: 1128553375
effective search space used: 1128553375
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 49 (23.5 bits)