BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 027686
(220 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4E2Q|A Chain A, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|B Chain B, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|C Chain C, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|D Chain D, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|E Chain E, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|F Chain F, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|G Chain G, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|H Chain H, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|I Chain I, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|J Chain J, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|K Chain K, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|L Chain L, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|M Chain M, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|N Chain N, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|O Chain O, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|P Chain P, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2S|A Chain A, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|B Chain B, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|C Chain C, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|D Chain D, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|E Chain E, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|F Chain F, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|G Chain G, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|H Chain H, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|I Chain I, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|J Chain J, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|K Chain K, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|L Chain L, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|M Chain M, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|N Chain N, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|O Chain O, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|P Chain P, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
Length = 266
Score = 31.6 bits (70), Expect = 0.34, Method: Compositional matrix adjust.
Identities = 44/166 (26%), Positives = 68/166 (40%), Gaps = 23/166 (13%)
Query: 35 VIEMVSGSLLRSNRSSYAPLSTEDPGPSSSDAFSVGLPPAWVD--DAEEIANLSSFGDGK 92
+I +V G++ +N SS + T D S A+ LPP + D E A L F
Sbjct: 93 LIFVVEGAVTLTNTSSSSKKLTVD-----SYAY---LPPNFHHSLDCVESATLVVF---- 140
Query: 93 QDQHMIEILTYEITDLLRGSEKRLDKLSAAGSSEDSNLRKNVQHSLATDLQNHSMDLRKN 152
+ E L T+L+ GS + L G E LRK + S+A D H+MD +
Sbjct: 141 --ERRYEYLGSHTTELIVGSTDKQPLLETPG--EVFELRKLLPMSVAYDFNIHTMDFQPG 196
Query: 153 HSTYLKHLQQQKEGCDGVDLEMNFNEDKYRLEDDGFSDGGFDAHQM 198
+K + + G ++ + YRL D+ + D M
Sbjct: 197 EFLNVKEVHYNQHGLLLLE-----GQGIYRLGDNWYPVQAGDVIWM 237
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.129 0.365
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,092,226
Number of Sequences: 62578
Number of extensions: 235997
Number of successful extensions: 330
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 330
Number of HSP's gapped (non-prelim): 5
length of query: 220
length of database: 14,973,337
effective HSP length: 95
effective length of query: 125
effective length of database: 9,028,427
effective search space: 1128553375
effective search space used: 1128553375
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 49 (23.5 bits)