Citrus Sinensis ID: 027700


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MGTPTREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQVCFIPHGCQRLIIIILLF
ccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHEccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHccccccEEEccc
****TRE*YVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSI***************VKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQVCFIPHGCQRLIIIILLF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTPTREQYVYxxxxxxxxxxxxxxxxxxxxxVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQVCFIPHGCQRLIIIILLF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
14-3-3-like protein B (Fragment) confidentQ96451
14-3-3-like protein GF14 kappa Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.confidentP48348
14-3-3-like protein GF14-C Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.probableQ6ZKC0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BR9, chain A
Confidence level:very confident
Coverage over the Query: 5-213
View the alignment between query and template
View the model in PyMOL