Citrus Sinensis ID: 027705


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MAILYALVARGTVVLAEFSAVTGNTGAVARRIIEKLPAESDSRVCFSQDRYIFHILRSDGLTFLCMANDTFGRRIPFSYLEDIQMRFMKNYGRVAHYAPAYAMNDEFSRVLHQQMEFFSSNPSADTLNRVRGEVSEIRTIMVENIEKILERGDRIELLVDKTATMQDGAFHFRKQSKRLRRALWMKNAKLLALLTGLIVLLLYIIIAAACGGITLPSCRS
ccEEEEEEEcccEEEEEEccccccHHHHHHHHHHHcccccccCEEEECccEEEEEEEEccEEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
MAILYALVARGTVVLAEFSAVTGNTGAVARRIIEKLPAESDSRVCFSQDRYIFHILRSDGLTFLCMANDTFGRRIPFSYLEDIQMRFMKNYGRVAHYAPAYAMNDEFSRVLHQQMEFF********LNRVRGEVSEIRTIMVENIEKILERGDRIELLVDKTATMQDGAFHFRKQSKRLRRALWMKNAKLLALLTGLIVLLLYIIIAAACGGITLPSC**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAILYALVARGTVVLAEFSAVTGNTGAVARRIIEKLPAESDSRVCFSQDRYIFHILRSDGLTFLCMANDTFGRRIPFSYLEDIQMRFMKNYGRVAHYAPAYAMNDEFSRVLHQQMEFFSSNPSADTLNRVRGEVSEIRTIMVENIEKILERGDRIELLVDKTATMQDGAFHFRKQSKRLRRALWMKNAKLLALLTGLIVLLLYIIIAAACGGITLPSCRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle-associated membrane protein 714 Involved in the targeting and/or fusion of transport vesicles to their target membrane.confidentQ9FMR5
Vesicle-associated membrane protein 7B Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion.probableQ86AQ7
Vesicle-associated membrane protein 7 Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.probableQ5RF94

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AFI, chain A
Confidence level:very confident
Coverage over the Query: 1-120
View the alignment between query and template
View the model in PyMOL
Template: 4B93, chain A
Confidence level:very confident
Coverage over the Query: 1-164
View the alignment between query and template
View the model in PyMOL
Template: 2KOG, chain A
Confidence level:very confident
Coverage over the Query: 121-210
View the alignment between query and template
View the model in PyMOL