Query         027714
Match_columns 220
No_of_seqs    179 out of 1037
Neff          6.9 
Searched_HMMs 46136
Date          Fri Mar 29 14:04:57 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/027714.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/027714hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3882 Tetraspanin family int  99.9 1.6E-26 3.5E-31  197.6  15.3  164    1-169     1-232 (237)
  2 PF00335 Tetraspannin:  Tetrasp  99.7   6E-19 1.3E-23  145.0  -0.0  152    8-164     1-220 (221)
  3 KOG4433 Tweety transmembrane/c  94.6     1.1 2.4E-05   42.4  13.4   39   62-100   214-252 (526)
  4 PF15050 SCIMP:  SCIMP protein   90.2     0.9   2E-05   35.2   5.6   32  131-163     2-33  (133)
  5 PRK10263 DNA translocase FtsK;  88.0      23 0.00049   37.9  15.4   15   59-73     76-90  (1355)
  6 cd03164 CD53_like_LEL Tetraspa  87.9    0.32   7E-06   34.5   1.7   21  121-141    66-86  (86)
  7 PF04906 Tweety:  Tweety;  Inte  86.5     2.4 5.3E-05   39.4   7.1   34   66-99    194-227 (406)
  8 PF07086 DUF1352:  Protein of u  84.1     9.8 0.00021   31.8   8.8   84   14-111    41-124 (186)
  9 PF04103 CD20:  CD20-like famil  81.3    0.53 1.1E-05   36.6   0.3   68   19-99      5-72  (150)
 10 PRK12585 putative monovalent c  81.0      27 0.00059   29.3  10.3   56   13-78      5-60  (197)
 11 PF15345 TMEM51:  Transmembrane  74.4     5.5 0.00012   34.3   4.5   17   58-74     61-77  (233)
 12 PF05915 DUF872:  Eukaryotic pr  72.6      11 0.00023   29.1   5.3   47   15-73     45-91  (115)
 13 cd07912 Tweety_N N-terminal do  70.1      16 0.00034   34.4   6.8   39   62-100   213-251 (418)
 14 PF10724 DUF2516:  Protein of u  68.9      29 0.00063   26.0   6.8   29   10-38      2-30  (100)
 15 PF06341 DUF1056:  Protein of u  68.3      36 0.00078   23.4   6.7   49    6-74      4-52  (63)
 16 PF04156 IncA:  IncA protein;    67.0      12 0.00026   30.6   4.9   24   13-36      4-27  (191)
 17 PF05640 NKAIN:  Na,K-Atpase In  57.2 1.2E+02  0.0026   25.7  10.4   40   62-101    37-76  (200)
 18 PF14995 TMEM107:  Transmembran  57.2      32  0.0007   26.7   5.4   63   96-161     7-71  (124)
 19 PF12273 RCR:  Chitin synthesis  55.1      10 0.00022   29.4   2.3   24  141-164     1-24  (130)
 20 PF01601 Corona_S2:  Coronaviru  53.0     4.5 9.8E-05   39.4   0.0   17   54-70    546-562 (610)
 21 cd03158 penumbra_like_LEL Tetr  52.6     9.6 0.00021   28.6   1.8   17  121-137   103-119 (119)
 22 cd03166 CD63_LEL Tetraspanin,   51.8     7.6 0.00016   28.0   1.1   17  121-137    83-99  (99)
 23 cd03167 oculospanin_like_LEL T  51.2     9.6 0.00021   28.8   1.6   17  121-137   104-120 (120)
 24 cd03161 TM4SF2_6_like_LEL Tetr  50.2      10 0.00022   27.4   1.5   17  121-137    88-104 (104)
 25 cd03163 TM4SF8_like_LEL Tetras  50.1     8.8 0.00019   27.9   1.2   17  121-137    88-104 (105)
 26 cd03154 TM4SF3_like_LEL Tetras  49.9      12 0.00025   27.0   1.8   17  121-137    84-100 (100)
 27 cd03165 NET-5_like_LEL Tetrasp  47.1      10 0.00022   27.1   1.1   17  121-137    82-98  (98)
 28 PF09323 DUF1980:  Domain of un  46.1 1.1E+02  0.0024   24.9   7.3   29   57-85     31-59  (182)
 29 cd03152 CD9_LEL Tetraspanin, e  45.6      14  0.0003   26.0   1.6   17  121-137    68-84  (84)
 30 PF13903 Claudin_2:  PMP-22/EMP  45.2 1.3E+02  0.0028   23.2   7.4   29   60-88     73-102 (172)
 31 cd03160 CD37_CD82_like_LEL Tet  44.9     9.8 0.00021   28.3   0.7   17  121-137   100-116 (117)
 32 cd03159 TM4SF9_like_LEL Tetras  44.7      12 0.00026   28.2   1.2   17  121-137   105-121 (121)
 33 cd03155 CD151_like_LEL Tetrasp  44.2      16 0.00035   26.7   1.9   15  123-137    96-110 (110)
 34 PF06724 DUF1206:  Domain of Un  42.1      32 0.00069   23.7   3.0   21   17-37     47-67  (73)
 35 PF10176 DUF2370:  Protein of u  41.6      37 0.00081   29.3   3.9   33   53-85    192-224 (233)
 36 PF11127 DUF2892:  Protein of u  41.4      69  0.0015   21.5   4.5   23   59-81     34-56  (66)
 37 PRK12587 putative monovalent c  39.6 1.8E+02  0.0038   22.5  10.3   32    9-40      2-33  (118)
 38 PF11297 DUF3098:  Protein of u  39.4      67  0.0014   22.5   4.2   23   16-38      6-28  (69)
 39 PF15125 TMEM238:  TMEM238 prot  38.4   1E+02  0.0022   21.3   4.8   45   14-77      7-51  (65)
 40 cd03156 uroplakin_I_like_LEL T  38.1      20 0.00044   26.1   1.5   17  121-137    98-114 (114)
 41 PF10812 DUF2561:  Protein of u  37.7 1.2E+02  0.0026   25.7   6.2   55   13-70     24-78  (207)
 42 KOG3950 Gamma/delta sarcoglyca  36.2      53  0.0012   28.8   3.9   26   84-109    34-59  (292)
 43 cd03127 tetraspanin_LEL Tetras  34.7      23 0.00049   24.4   1.3   17  121-137    74-90  (90)
 44 PRK12586 putative monovalent c  34.2 2.4E+02  0.0053   22.5  10.8   29   12-40      7-35  (145)
 45 PF11381 DUF3185:  Protein of u  33.9      25 0.00054   23.9   1.3   55   17-75      4-58  (59)
 46 KOG4812 Golgi-associated prote  32.1      61  0.0013   28.3   3.6   30   55-84    223-252 (262)
 47 PF04156 IncA:  IncA protein;    31.9 2.2E+02  0.0048   22.9   7.0   22   60-81     10-31  (191)
 48 PF12273 RCR:  Chitin synthesis  31.4      47   0.001   25.6   2.7    7  172-178    78-84  (130)
 49 PF13706 PepSY_TM_3:  PepSY-ass  31.4      82  0.0018   18.9   3.2   24   59-82     10-33  (37)
 50 COG4993 Gcd Glucose dehydrogen  30.2 1.3E+02  0.0029   29.9   6.0   63   13-97      3-65  (773)
 51 PF10731 Anophelin:  Thrombin i  29.6      93   0.002   21.3   3.4   26  152-177    10-38  (65)
 52 PF05478 Prominin:  Prominin;    28.4      46   0.001   33.8   2.7   26   85-110   137-162 (806)
 53 COG4298 Uncharacterized protei  28.2 1.9E+02  0.0042   21.2   5.1   20   15-34     18-37  (95)
 54 PRK11901 hypothetical protein;  27.8      55  0.0012   29.7   2.8   24   59-82     37-60  (327)
 55 KOG3658 Tumor necrosis factor-  27.4      88  0.0019   31.3   4.3   25  127-151   673-697 (764)
 56 PRK07946 putative monovalent c  26.8      89  0.0019   25.6   3.6   22   16-37      3-24  (163)
 57 PF10177 DUF2371:  Uncharacteri  26.3      44 0.00096   26.7   1.7   24   12-35     41-64  (141)
 58 PRK02935 hypothetical protein;  25.8   3E+02  0.0065   21.0   6.5   38   59-101    17-54  (110)
 59 PRK06654 fliL flagellar basal   24.4 1.1E+02  0.0023   25.5   3.7   27  138-164    32-58  (181)
 60 PF11014 DUF2852:  Protein of u  24.1      77  0.0017   24.4   2.6   17   18-34     20-36  (115)
 61 PF11359 gpUL132:  Glycoprotein  24.0 2.1E+02  0.0045   24.6   5.3   27  135-161    49-75  (235)
 62 PF08611 DUF1774:  Fungal prote  24.0 2.1E+02  0.0046   21.4   4.8    8  180-187    90-97  (97)
 63 PF12805 FUSC-like:  FUSC-like   23.6 4.5E+02  0.0099   22.7   7.8   21   60-80     26-46  (284)
 64 PF10873 DUF2668:  Protein of u  23.4   4E+02  0.0087   21.5   8.1   20  131-150    52-73  (155)
 65 PRK12585 putative monovalent c  21.0   1E+02  0.0023   25.9   3.0   21   57-77      8-28  (197)
 66 PHA03283 envelope glycoprotein  20.9 1.9E+02  0.0041   28.0   5.1    8  172-179   461-468 (542)
 67 PRK15033 tricarballylate utili  20.6 6.7E+02   0.015   23.4   8.4   14   18-31    275-288 (389)
 68 PF13314 DUF4083:  Domain of un  20.2 1.6E+02  0.0034   19.9   3.2   30  148-177    14-43  (58)

No 1  
>KOG3882 consensus Tetraspanin family integral membrane protein [General function prediction only]
Probab=99.94  E-value=1.6e-26  Score=197.59  Aligned_cols=164  Identities=22%  Similarity=0.285  Sum_probs=135.8

Q ss_pred             CccchhhHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccccccccccCccCCCchhhhHHHHhHHHHHHHHHHHhhhHHh
Q 027714            1 MERIAITCLQSFLKALNLIMGIVGISMILYGIWMIRVWQRDMEGQSFDDFCSINPWFICSFIGIGVTFCLITCLGHIAAA   80 (220)
Q Consensus         1 M~~~~~~clK~lL~~~N~l~~l~Gl~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~i~~li~vG~il~~is~lGc~GA~   80 (220)
                      |.+++.+|+|++++++|+++|++|++++++|+|+..+...+.+..+  .....   ..++++++|++++++|++||+||.
T Consensus         1 ~~~~~~~~~K~~lf~~N~~~~l~G~~ll~~giw~~~~~~~~~~~~~--~~~~~---~~~ili~~G~v~~~v~flGc~Ga~   75 (237)
T KOG3882|consen    1 MMSCGSSCLKYLLFLLNLLFWLLGLLLLAVGIWLLADKGFLSSLLE--SDFLV---PAYILIAVGGVVFLVGFLGCCGAL   75 (237)
T ss_pred             CCCcccchHHHHHHHHHHHHHHHHHHHHHhhhheeEeccchhhccc--cchhc---chhhhhhhhHHHHHHHHhhhhhhH
Confidence            3467899999999999999999999999999999887655433110  00011   236899999999999999999999


Q ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHHhHhhcc---------------------------------------------cccc
Q 027714           81 SANGFCLSFYMLITCLLLLLETAIAADIQLN---------------------------------------------SEWE  115 (220)
Q Consensus        81 ~es~c~L~~Y~~ll~ll~llE~~~~~~~~~~---------------------------------------------~dW~  115 (220)
                      |||+|+|.+|++++++++++|++++++.+..                                             .||.
T Consensus        76 ~es~~lL~~y~~~l~l~~i~e~~~~i~~~~~~~~l~~~~~~~~~~~~~~~y~~~~~~~~~~d~~Q~~~~CCG~~~~~~~~  155 (237)
T KOG3882|consen   76 RESRCLLLSYFILLLLLFIAELAAGILAFVFRDSLRDELEEQLLKSIWNNYSSDPDLGEAWDKLQRELKCCGVNGYSDYF  155 (237)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHHHhheeHHHHHHHHHHHHHHHHHHHhCCCccHHHHHHHHHHhccCCcCCCchHHh
Confidence            9999999999999999999999998877632                                             1221


Q ss_pred             c--C--CCC-------------------CCCChHHHHHHHHHhccchhhhHHHHHHHHHHHHHHHHHHHHhhccCCC
Q 027714          116 K--D--LPD-------------------DPTGRFHDFKKFVKSNFDIFKWIGIWIISAQVSSALLAMALRALGSNQG  169 (220)
Q Consensus       116 ~--~--~P~-------------------~~~Gc~~~~~~~i~~~~~i~~~v~i~v~~~q~l~~ilA~~L~~~~~~~~  169 (220)
                      +  .  +|+                   +.+||.+++++++++|+..+++++++++++|++++++|+.|....++++
T Consensus       156 ~~~~~~vP~SCC~~~~~~~~~~~~~~~~~~~GC~~~~~~~~~~~~~~i~~~~~~i~~~~~~~~~~a~~l~~~i~~~~  232 (237)
T KOG3882|consen  156 NCSSNNVPPSCCKRTRRQKFPQDVPDNIYTEGCLEKLSSWLESNLLIIGGVGLGIAVLELLGMILACCLANAIRNQR  232 (237)
T ss_pred             cCCCCCCCcccCCCcccccccccchhhhhccccHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            1  1  454                   2579999999999999999999999999999999999999987776644


No 2  
>PF00335 Tetraspannin:  Tetraspanin family RDS_ROM1 subfamily;  InterPro: IPR018499 A number of eukaryotic CD antigens have been shown to be related []. CD9 (also called DRAP-27, MRP-1 or p24) upregulates HB-EGF activity as a receptor for diphtheria toxin as well as its juxtacrine activity. CD9 mAbs modulate cell adhesion and migration and trigger platelet activation that is blocked by mAbs directed to the platelet Fc receptor CD32. In mice, CD9 mAb KMC8.8 has been shown to inhibit the production of myeloid cells in vitro and has a costimulatory activity for T cells. CD9 is a type III membrane protein, with four putative transmembrane domains.  CD37 (or gp52-40) is involved in signal transduction and serves as a stable marker for malignancies derived from mature B cells, like B-CLL, HCL, and all types of B-NHL.  CD63 transfection reduced melanoma cell motility on fibronectin, collagen and laminin, and reduced the growth and metastasis of melanoma cells in nude mice []. CD63 has been used as a marker for late endosomes and for primary melanomas.  These proteins are all type II membrane proteins: they contain an N-terminal transmembrane (TM) domain, which acts both as a signal sequence and a membrane anchor, and 3 additional TM regions (hence the name 'TM4'). The sequences contain a number of conserved cysteine residues. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0016021 integral to membrane; PDB: 1IV5_A 1G8Q_A.
Probab=99.72  E-value=6e-19  Score=144.96  Aligned_cols=152  Identities=24%  Similarity=0.384  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccccccccccCccCCCchhhhHHHHhHHHHHHHHHHHhhhHHhhhhhhHH
Q 027714            8 CLQSFLKALNLIMGIVGISMILYGIWMIRVWQRDMEGQSFDDFCSINPWFICSFIGIGVTFCLITCLGHIAAASANGFCL   87 (220)
Q Consensus         8 clK~lL~~~N~l~~l~Gl~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~i~~li~vG~il~~is~lGc~GA~~es~c~L   87 (220)
                      |+|+++.++|++++++|++++++|+|+....+.....  . .  .......++++.+|+++++++++||+|+.++|+|++
T Consensus         1 c~k~~l~~~n~l~~l~g~~li~~g~~~~~~~~~~~~~--~-~--~~~~~~~~~~i~~G~~~~~~~~~G~~~~~~~~~~~l   75 (221)
T PF00335_consen    1 CLKYILFFLNVLFLLLGLALIGVGIWLLVNNQYLSEF--S-S--SFISYVIIILIFIGIFILIISFLGCIGACRKNRCLL   75 (221)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccc--c-c--cchhHHHHHHHHHHHHHHHHHHHHHHHHhhcCcccc
Confidence            7899999999999999999999999984221111110  0 0  011112356777999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHhHhhcc---------------------------------------------cccccCC----
Q 027714           88 SFYMLITCLLLLLETAIAADIQLN---------------------------------------------SEWEKDL----  118 (220)
Q Consensus        88 ~~Y~~ll~ll~llE~~~~~~~~~~---------------------------------------------~dW~~~~----  118 (220)
                      ..|.+++++++++|+++++..+..                                             +||.+..    
T Consensus        76 ~~y~~~~~~~~v~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iq~~~~CCG~~~~~d~~~~~~~~~  155 (221)
T PF00335_consen   76 IIYIILLILLFVLELVVGIVAFSYRDQLNSSLKDGLSLRCMKSYNSNESFSEAWDNIQEKFECCGVNSPDDWFTSKWSSC  155 (221)
T ss_dssp             ------------------------HHHHHHHHHHHHHHHHHHSSTT-CHHHHHHHHHHHHHT--SSTTCHHHHHHHHHT-
T ss_pred             cccccchhhHHHHHHHHHHhhhhccccccccccccccchhhhccccccchhhheecccccccccCCCCCccccccccccc
Confidence            999999999999999887655431                                             1221100    


Q ss_pred             -------------------CCCCCChHHHHHHHHHhccchhhhHHHHHHHHHHHHHHHHHHHHhh
Q 027714          119 -------------------PDDPTGRFHDFKKFVKSNFDIFKWIGIWIISAQVSSALLAMALRAL  164 (220)
Q Consensus       119 -------------------P~~~~Gc~~~~~~~i~~~~~i~~~v~i~v~~~q~l~~ilA~~L~~~  164 (220)
                                         +.+.+||.+++.++++++.....+++++++++|++++++|++|++.
T Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~gC~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~a~~l~~~  220 (221)
T PF00335_consen  156 SSPDSCPDCQCPDDCSSENSIYTRGCYDKLREYLRSYLKYIGIVSLAILVLQLIGIILACCLCRH  220 (221)
T ss_dssp             --------TCS-TTCCCCHCCTST-HHHHHHHHHCT-----------------------------
T ss_pred             ccccccccccccccccccccccCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence                               0146799999999999999999999999999999999999998653


No 3  
>KOG4433 consensus Tweety transmembrane/cell surface protein [General function prediction only]
Probab=94.58  E-value=1.1  Score=42.40  Aligned_cols=39  Identities=10%  Similarity=0.101  Sum_probs=31.6

Q ss_pred             HhHHHHHHHHHHHhhhHHhhhhhhHHHHHHHHHHHHHHH
Q 027714           62 IGIGVTFCLITCLGHIAAASANGFCLSFYMLITCLLLLL  100 (220)
Q Consensus        62 i~vG~il~~is~lGc~GA~~es~c~L~~Y~~ll~ll~ll  100 (220)
                      ++.=.+.+++-++++.|-.|+|||.+..|++.-++.+++
T Consensus       214 v~lL~l~LvvC~v~vlglak~Skc~li~fsv~Gll~lvi  252 (526)
T KOG4433|consen  214 VLLLTLLLVVCLVLVLGLAKRSKCLLIVFSVCGLLALVI  252 (526)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcchhhhHHHHHHHHHHHH
Confidence            344567788888899999999999999999877766654


No 4  
>PF15050 SCIMP:  SCIMP protein
Probab=90.24  E-value=0.9  Score=35.23  Aligned_cols=32  Identities=22%  Similarity=0.256  Sum_probs=22.5

Q ss_pred             HHHHhccchhhhHHHHHHHHHHHHHHHHHHHHh
Q 027714          131 KFVKSNFDIFKWIGIWIISAQVSSALLAMALRA  163 (220)
Q Consensus       131 ~~i~~~~~i~~~v~i~v~~~q~l~~ilA~~L~~  163 (220)
                      +|.++|+-++-+++|.++ --.+|+++-|+.|.
T Consensus         2 ~WWr~nFWiiLAVaII~v-S~~lglIlyCvcR~   33 (133)
T PF15050_consen    2 SWWRDNFWIILAVAIILV-SVVLGLILYCVCRW   33 (133)
T ss_pred             chHHhchHHHHHHHHHHH-HHHHHHHHHHHHHH
Confidence            688999999998886543 34466776666543


No 5  
>PRK10263 DNA translocase FtsK; Provisional
Probab=87.99  E-value=23  Score=37.94  Aligned_cols=15  Identities=7%  Similarity=-0.029  Sum_probs=9.4

Q ss_pred             HHHHhHHHHHHHHHH
Q 027714           59 CSFIGIGVTFCLITC   73 (220)
Q Consensus        59 ~~li~vG~il~~is~   73 (220)
                      +.+++++++++.+.+
T Consensus        76 ~~LFGl~AYLLP~LL   90 (1355)
T PRK10263         76 FFIFGVMAYTIPVII   90 (1355)
T ss_pred             HHHHhHHHHHHHHHH
Confidence            456777777766543


No 6  
>cd03164 CD53_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), CD53_Like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD53 is a tetraspanin of the lymphoid-myeloid lineage and has been implicated in apoptosis protection. It associates with integrin alpha4beta1. Some of the cellular responses modulated by CD53 may be mediated by JNK activation and/or via the AKT pathway.
Probab=87.93  E-value=0.32  Score=34.53  Aligned_cols=21  Identities=24%  Similarity=0.400  Sum_probs=18.0

Q ss_pred             CCCChHHHHHHHHHhccchhh
Q 027714          121 DPTGRFHDFKKFVKSNFDIFK  141 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~~i~~  141 (220)
                      +.+||.+++.+|+++|+.+++
T Consensus        66 ~~~GC~~~~~~~~~~~~~iig   86 (86)
T cd03164          66 KVEGCYKKLKNWFESNFLYTG   86 (86)
T ss_pred             ccccHHHHHHHHHHHHHHHhC
Confidence            467999999999999988653


No 7  
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=86.50  E-value=2.4  Score=39.40  Aligned_cols=34  Identities=21%  Similarity=0.261  Sum_probs=25.3

Q ss_pred             HHHHHHHHHhhhHHhhhhhhHHHHHHHHHHHHHH
Q 027714           66 VTFCLITCLGHIAAASANGFCLSFYMLITCLLLL   99 (220)
Q Consensus        66 ~il~~is~lGc~GA~~es~c~L~~Y~~ll~ll~l   99 (220)
                      ++.+++.++++.|..|+|||.+.+++++-++.++
T Consensus       194 ~l~l~icl~~l~glar~Sk~~li~~~v~gll~lv  227 (406)
T PF04906_consen  194 ILDLVICLLGLLGLARQSKCLLIVFSVLGLLALV  227 (406)
T ss_pred             HHHHHHHHHHHHHHHhcCcceEEEeeeccHHHHH
Confidence            4666677788899999999999877665544443


No 8  
>PF07086 DUF1352:  Protein of unknown function (DUF1352);  InterPro: IPR009787 This family consists of several hypothetical eukaryotic proteins of around 190 residues in length. The function of this family is unknown.
Probab=84.13  E-value=9.8  Score=31.78  Aligned_cols=84  Identities=15%  Similarity=0.110  Sum_probs=47.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhcccccccccccCccCCCchhhhHHHHhHHHHHHHHHHHhhhHHhhhhhhHHHHHHHH
Q 027714           14 KALNLIMGIVGISMILYGIWMIRVWQRDMEGQSFDDFCSINPWFICSFIGIGVTFCLITCLGHIAAASANGFCLSFYMLI   93 (220)
Q Consensus        14 ~~~N~l~~l~Gl~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~i~~li~vG~il~~is~lGc~GA~~es~c~L~~Y~~l   93 (220)
                      +++++++++++++-++.+.-..++...         ...|.+| .|. -.++   ++.+++|-.|--|.|.-.|..|++-
T Consensus        41 ~~~h~ll~l~~~a~v~~~~L~~i~~~~---------~p~p~~W-ey~-~~lS---~ip~~~G~~s~~rN~i~~l~~y~~~  106 (186)
T PF07086_consen   41 ILFHALLWLLMAAKVSVDILLEISELQ---------IPSPYQW-EYI-WCLS---LIPSLLGLLSLRRNNISLLRLYMIG  106 (186)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhccc---------cCChhHH-HHH-HHHH---HHHHHHHHHhcccchHHHHHHHHHH
Confidence            466777777777766666654333211         0013334 343 2223   4455666677777777888888776


Q ss_pred             HHHHHHHHHHHHhHhhcc
Q 027714           94 TCLLLLLETAIAADIQLN  111 (220)
Q Consensus        94 l~ll~llE~~~~~~~~~~  111 (220)
                      .+++-+.=+..++.-.+.
T Consensus       107 ~~~~gl~pl~~g~~~~~~  124 (186)
T PF07086_consen  107 SSLFGLLPLIYGAMYYFP  124 (186)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            666555555555554444


No 9  
>PF04103 CD20:  CD20-like family;  InterPro: IPR007237  This family includes the CD20 protein and the beta subunit of the high affinity receptor for IgE Fc. The high affinity receptor for IgE is a tetrameric structure consisting of a single IgE-binding alpha subunit, a single beta subunit, and two disulphide-linked gamma subunits. The alpha subunit of Fc epsilon RI and most Fc receptors are homologous members of the Ig superfamily. By contrast, the beta and gamma subunits from Fc epsilon RI are not homologous to the Ig superfamily. Both molecules have four putative transmembrane segments and a probably topology where both amino- and carboxy termini protrude into the cytoplasm []. This family also includes LR8 like proteins from humans, mice and rats. The function of the human LR8 protein is unknown although it is known to be strongly expressed in the lung fibroblasts []. This family also includes sarcospan is a transmembrane component of dystrophin-associated glycoprotein. Loss of the sarcoglycan complex and sarcospan alone is sufficient to cause muscular dystrophy. The role of the sarcoglycan complex and sarcospan is thought to be to strengthen the dystrophin axis connecting the basement membrane with the cytoskeleton []. ; GO: 0016021 integral to membrane; PDB: 2OSL_Q 3BKY_P 3PP4_P.
Probab=81.25  E-value=0.53  Score=36.59  Aligned_cols=68  Identities=18%  Similarity=0.160  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHhhhhcccccccccccCccCCCchhhhHHHHhHHHHHHHHHHHhhhHHhhhhhhHHHHHHHHHHHHH
Q 027714           19 IMGIVGISMILYGIWMIRVWQRDMEGQSFDDFCSINPWFICSFIGIGVTFCLITCLGHIAAASANGFCLSFYMLITCLLL   98 (220)
Q Consensus        19 l~~l~Gl~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~i~~li~vG~il~~is~lGc~GA~~es~c~L~~Y~~ll~ll~   98 (220)
                      +..++|+..+.+|+.+........       ....      .-+-.|++.++.|.+|.....|.++|++..++.+-++-+
T Consensus         5 ~qI~lGi~~i~lGi~~~~~~~~~~-------~~~~------~piW~G~~fiisG~l~i~s~k~~~~~lv~~~l~lsi~s~   71 (150)
T PF04103_consen    5 IQILLGILSIVLGIIALSLSSSVL-------VYIG------YPIWGGIFFIISGILGIASEKKPTKCLVIASLVLSIVSA   71 (150)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHhHHH-------HHhc------ccHHHHHHHHhhHHHHHHHhcCCcccchHHHHHHHHHHH
Confidence            456778888888888665332200       0011      123448888999999999999999998887776555444


Q ss_pred             H
Q 027714           99 L   99 (220)
Q Consensus        99 l   99 (220)
                      +
T Consensus        72 ~   72 (150)
T PF04103_consen   72 L   72 (150)
T ss_dssp             -
T ss_pred             H
Confidence            3


No 10 
>PRK12585 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=81.02  E-value=27  Score=29.32  Aligned_cols=56  Identities=13%  Similarity=0.084  Sum_probs=32.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhcccccccccccCccCCCchhhhHHHHhHHHHHHHHHHHhhhH
Q 027714           13 LKALNLIMGIVGISMILYGIWMIRVWQRDMEGQSFDDFCSINPWFICSFIGIGVTFCLITCLGHIA   78 (220)
Q Consensus        13 L~~~N~l~~l~Gl~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~i~~li~vG~il~~is~lGc~G   78 (220)
                      +-++-.++.++|+.++.+|..-+....++....+    ..+      ..-.+|+.++++|.+++..
T Consensus         5 ~eiI~~vLLliG~~f~ligaIGLlRfPD~YtRLH----AAT------Ka~TLGv~LILlgv~l~~~   60 (197)
T PRK12585          5 IEIIISIMILIGGLLSILAAIGVIRLPDVYTRTH----AAG------ISNTFGVSLLLFATVGYFF   60 (197)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcCcHHHHhh----ccc------cchhhhHHHHHHHHHHHHH
Confidence            3455667778888888888876665544322111    111      2245566777777666554


No 11 
>PF15345 TMEM51:  Transmembrane protein 51
Probab=74.44  E-value=5.5  Score=34.30  Aligned_cols=17  Identities=24%  Similarity=0.479  Sum_probs=15.1

Q ss_pred             hHHHHhHHHHHHHHHHH
Q 027714           58 ICSFIGIGVTFCLITCL   74 (220)
Q Consensus        58 i~~li~vG~il~~is~l   74 (220)
                      .|+++++|+++++++++
T Consensus        61 AyVLVG~Gv~LLLLSIC   77 (233)
T PF15345_consen   61 AYVLVGSGVALLLLSIC   77 (233)
T ss_pred             EEehhhHHHHHHHHHHH
Confidence            48999999999999983


No 12 
>PF05915 DUF872:  Eukaryotic protein of unknown function (DUF872);  InterPro: IPR008590 This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown.
Probab=72.64  E-value=11  Score=29.09  Aligned_cols=47  Identities=15%  Similarity=0.195  Sum_probs=30.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhcccccccccccCccCCCchhhhHHHHhHHHHHHHHHH
Q 027714           15 ALNLIMGIVGISMILYGIWMIRVWQRDMEGQSFDDFCSINPWFICSFIGIGVTFCLITC   73 (220)
Q Consensus        15 ~~N~l~~l~Gl~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~i~~li~vG~il~~is~   73 (220)
                      .+-+.++++|..++..|..+....-.  .       .....   +.++++|+++++=|+
T Consensus        45 ~la~~Lli~G~~li~~g~l~~~~~i~--~-------~~~~~---~~llilG~L~fIPG~   91 (115)
T PF05915_consen   45 ALAVFLLIFGTVLIIIGLLLFFGHID--G-------DRDRG---WALLILGILCFIPGF   91 (115)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcccC--C-------CCccc---chHHHHHHHHHhccH
Confidence            44566778899999999888765311  0       01122   467888998887665


No 13 
>cd07912 Tweety_N N-terminal domain of the protein encoded by the Drosophila tweety gene and related proteins, a family of chloride ion channels. The protein product of the Drosophila tweety (tty) gene is thought to form a trans-membrane protein with five membrane-spanning regions and a cytoplasmic C-terminus. This N-terminal domain contains the putative transmembrane spanning regions. Tweety has been suggested as a candidate for a large conductance chloride channel, both in vertebrate and insect cells. Three human homologs have been identified and designated TTYH1-3. TTYH2 has been associated with the progression of cancer, and Drosophila melanogaster tweety has been assumed to play a role in development. TTYH2, and TTYH3 bind to and are ubiquinated by Nedd4-2, a HECT type E3 ubiquitin ligase, which most likely plays a role in controlling the cellular levels of tweety family proteins.
Probab=70.14  E-value=16  Score=34.36  Aligned_cols=39  Identities=13%  Similarity=0.183  Sum_probs=28.9

Q ss_pred             HhHHHHHHHHHHHhhhHHhhhhhhHHHHHHHHHHHHHHH
Q 027714           62 IGIGVTFCLITCLGHIAAASANGFCLSFYMLITCLLLLL  100 (220)
Q Consensus        62 i~vG~il~~is~lGc~GA~~es~c~L~~Y~~ll~ll~ll  100 (220)
                      +++=++.+++..++|+|..|.|||.+.+++++-++.+++
T Consensus       213 l~lL~~~lviC~~~l~gl~r~Sr~~li~~s~~g~l~l~~  251 (418)
T cd07912         213 LGLLSLLLVICLVLLVGLARHSRCLLIVFSVCGLFALII  251 (418)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcchHHHHHHHHHHHHHHH
Confidence            344446667777789999999999999987665555543


No 14 
>PF10724 DUF2516:  Protein of unknown function (DUF2516);  InterPro: IPR019662  This entry represents a conserved protein in Actinobacteria. The function is not known. 
Probab=68.88  E-value=29  Score=26.02  Aligned_cols=29  Identities=7%  Similarity=0.244  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhhcc
Q 027714           10 QSFLKALNLIMGIVGISMILYGIWMIRVW   38 (220)
Q Consensus        10 K~lL~~~N~l~~l~Gl~li~~Giw~~~~~   38 (220)
                      ..+..+.+.+++++.++.++.++|.+.+-
T Consensus         2 ~~l~~~~~~i~~~l~~~~~~~~v~Alv~a   30 (100)
T PF10724_consen    2 SFLFQIQGWILLALSLVALVLAVWALVDA   30 (100)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35667788899999999999999988764


No 15 
>PF06341 DUF1056:  Protein of unknown function (DUF1056);  InterPro: IPR009406 This entry is represented by Bacteriophage bIL286, Orf42. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several putative head-tail joining bacteriophage proteins.
Probab=68.29  E-value=36  Score=23.42  Aligned_cols=49  Identities=20%  Similarity=0.373  Sum_probs=38.6

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccccccccccCccCCCchhhhHHHHhHHHHHHHHHHH
Q 027714            6 ITCLQSFLKALNLIMGIVGISMILYGIWMIRVWQRDMEGQSFDDFCSINPWFICSFIGIGVTFCLITCL   74 (220)
Q Consensus         6 ~~clK~lL~~~N~l~~l~Gl~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~i~~li~vG~il~~is~l   74 (220)
                      .+..|.+=..+..++++.|+..+.++.+.+...                    .-++++|+.+++.|++
T Consensus         4 K~~fk~iW~~~DIi~Fila~i~i~it~F~~n~~--------------------~g~i~i~I~l~l~G~i   52 (63)
T PF06341_consen    4 KKFFKTIWKYFDIILFILAMIFINITAFLINQI--------------------AGLISIGITLFLAGLI   52 (63)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------------------HHHHHHHHHHHHHHHH
Confidence            457888889999999999999999999864321                    2467888888888775


No 16 
>PF04156 IncA:  IncA protein;  InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
Probab=66.99  E-value=12  Score=30.58  Aligned_cols=24  Identities=29%  Similarity=0.476  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhh
Q 027714           13 LKALNLIMGIVGISMILYGIWMIR   36 (220)
Q Consensus        13 L~~~N~l~~l~Gl~li~~Giw~~~   36 (220)
                      -.+.+.+..++|+++++.|+-.+.
T Consensus         4 ~~i~~i~~iilgilli~~gI~~Lv   27 (191)
T PF04156_consen    4 QRIISIILIILGILLIASGIAALV   27 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            346677777777777777776544


No 17 
>PF05640 NKAIN:  Na,K-Atpase Interacting protein;  InterPro: IPR008516 NKAIN (Na,K-Atpase INteracting) proteins are a family of evolutionary conserved transmembrane proteins that localise to neurons, that are critical for neuronal function, and that interact with the beta subunits, beta1 in vertebrates and beta in Drosophila, of Na,K-ATPase. NKAINs have highly conserved trans-membrane domains but otherwise no other characterised domains. NKAINs may function as subunits of pore or channel structures in neurons or they may affect the function of other membrane proteins. They are likely to function within the membrane bilayer [].
Probab=57.25  E-value=1.2e+02  Score=25.66  Aligned_cols=40  Identities=18%  Similarity=0.164  Sum_probs=27.3

Q ss_pred             HhHHHHHHHHHHHhhhHHhhhhhhHHHHHHHHHHHHHHHH
Q 027714           62 IGIGVTFCLITCLGHIAAASANGFCLSFYMLITCLLLLLE  101 (220)
Q Consensus        62 i~vG~il~~is~lGc~GA~~es~c~L~~Y~~ll~ll~llE  101 (220)
                      |.+=.+-.++-.+|..||..-++.-+.+|.+-..+=+..-
T Consensus        37 Il~NF~hIi~vIlGlFG~~QyR~ryi~~Y~vW~~~Wv~wN   76 (200)
T PF05640_consen   37 ILANFLHIIFVILGLFGAIQYRPRYIIVYAVWTALWVTWN   76 (200)
T ss_pred             HHHHHHHHHHHHHHHhhheeecchHHHHHHHHHHHHHHHh
Confidence            3334444445567888999999999999997666544433


No 18 
>PF14995 TMEM107:  Transmembrane protein
Probab=57.22  E-value=32  Score=26.72  Aligned_cols=63  Identities=14%  Similarity=0.082  Sum_probs=41.1

Q ss_pred             HHHHHHHHHHhHhhccccc--ccCCCCCCCChHHHHHHHHHhccchhhhHHHHHHHHHHHHHHHHHHH
Q 027714           96 LLLLLETAIAADIQLNSEW--EKDLPDDPTGRFHDFKKFVKSNFDIFKWIGIWIISAQVSSALLAMAL  161 (220)
Q Consensus        96 ll~llE~~~~~~~~~~~dW--~~~~P~~~~Gc~~~~~~~i~~~~~i~~~v~i~v~~~q~l~~ilA~~L  161 (220)
                      +.+++..++.+-++.++|-  +..+|.+.+.   +-++.-+..+..+-+++++..++|..|++.+.-+
T Consensus         7 l~l~~Hlvi~i~i~~~~~~nv~a~lp~~~~~---~~y~~~~~~l~v~L~~s~~~l~ie~~g~~sG~sm   71 (124)
T PF14995_consen    7 LTLIAHLVIVICIFWSREENVRACLPLDYTQ---AEYSTADTSLVVALSVSLLCLAIEFWGFFSGVSM   71 (124)
T ss_pred             HHHHHHHHHHHHHHHhHHhhhHhhCCCCCcH---HHHHHhhhheehHHHHHHHHHHHHHHHHHHhhcc
Confidence            3444455555556665543  3346643322   2366667788999999999999999999977543


No 19 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=55.11  E-value=10  Score=29.36  Aligned_cols=24  Identities=17%  Similarity=0.231  Sum_probs=14.9

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhh
Q 027714          141 KWIGIWIISAQVSSALLAMALRAL  164 (220)
Q Consensus       141 ~~v~i~v~~~q~l~~ilA~~L~~~  164 (220)
                      +|+.++++++=++.+++.++.++.
T Consensus         1 RW~l~~iii~~i~l~~~~~~~~~r   24 (130)
T PF12273_consen    1 RWVLFAIIIVAILLFLFLFYCHNR   24 (130)
T ss_pred             CeeeHHHHHHHHHHHHHHHHHHHH
Confidence            467777766666666666655433


No 20 
>PF01601 Corona_S2:  Coronavirus S2 glycoprotein;  InterPro: IPR002552 The type I glycoprotein S of Coronavirus, trimers of which constitute the typical viral spikes, is assembled into virions through noncovalent interactions with the M protein. The spike glycoprotein is translated as a large polypeptide that is subsequently cleaved to S1 IPR002551 from INTERPRO and S2 []. Both chimeric S proteins appeared to cause cell fusion when expressed individually, suggesting that they were biologically fully active []. The spike is a type I membrane glycoprotein that possesses a conserved transmembrane anchor and an unusual cysteine-rich (cys) domain that bridges the putative junction of the anchor and the cytoplasmic tail [].; GO: 0006944 cellular membrane fusion, 0046813 virion attachment, binding of host cell surface receptor, 0016021 integral to membrane, 0019031 viral envelope; PDB: 2BEQ_B 2FXP_A 1ZVB_A 1WNC_D 1ZV8_H 1ZV7_B 1WYY_B 1ZVA_A 2BEZ_F 1WDG_A ....
Probab=52.99  E-value=4.5  Score=39.39  Aligned_cols=17  Identities=18%  Similarity=0.407  Sum_probs=0.0

Q ss_pred             chhhhHHHHhHHHHHHH
Q 027714           54 NPWFICSFIGIGVTFCL   70 (220)
Q Consensus        54 ~~~~i~~li~vG~il~~   70 (220)
                      =||++|+.|+++.++++
T Consensus       546 WPWyVWL~i~~~li~~~  562 (610)
T PF01601_consen  546 WPWYVWLAIILALIAFA  562 (610)
T ss_dssp             -----------------
T ss_pred             hHHHHHHHHHHHHHHHH
Confidence            47888887777765543


No 21 
>cd03158 penumbra_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), penumbra_like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". Human Penumbra exhibits growth-suppressive activity in vitro and has been associated with myeloid malignancies.
Probab=52.62  E-value=9.6  Score=28.61  Aligned_cols=17  Identities=12%  Similarity=0.259  Sum_probs=15.1

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||++++.+|+++|+
T Consensus       103 ~~~GC~~~i~~~~~~n~  119 (119)
T cd03158         103 YTRGCIDAVVLWIEDNL  119 (119)
T ss_pred             cccchHHHHHHHHHhhC
Confidence            56799999999999985


No 22 
>cd03166 CD63_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), CD63 family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD63 is present in platelets, neutrophils, and endothelial cells, amongst others. In platelets it associates with the integrin alphaIIBbeta3 and may modulate alphaIIbbeta3-dependent cytoskeletal reorganization.
Probab=51.84  E-value=7.6  Score=27.97  Aligned_cols=17  Identities=18%  Similarity=0.341  Sum_probs=14.7

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||++++.+|+++|+
T Consensus        83 y~~GC~~~~~~~~~~~~   99 (99)
T cd03166          83 HLEGCVTKIEGWLKKNI   99 (99)
T ss_pred             HHhcCHHHHHHHHHHhC
Confidence            45699999999999874


No 23 
>cd03167 oculospanin_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), oculospanin_like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This subfamily contains sequences similar to oculospanin, which is found to be expressed in retinal pigment epithelium, iris, ciliary body, and retinal ganglion cells.
Probab=51.21  E-value=9.6  Score=28.82  Aligned_cols=17  Identities=12%  Similarity=0.317  Sum_probs=15.1

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||++++.+|+++|+
T Consensus       104 y~~GC~~~l~~~~~~n~  120 (120)
T cd03167         104 HLGGCGPPLRRWLRGNL  120 (120)
T ss_pred             hhccCHHHHHHHHHhcC
Confidence            46799999999999985


No 24 
>cd03161 TM4SF2_6_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), TM4SF2_6_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This subfamily contaions transmembrane 4 superfamily 2 (TM4SF2) or Tspan-7, transmembrane 4 superfamily 6 (TM4SF6) or Tspan-6, and related proteins. TM4SF2 has been identified as involved in some forms of X-linked mental retardation.
Probab=50.20  E-value=10  Score=27.39  Aligned_cols=17  Identities=24%  Similarity=0.407  Sum_probs=14.9

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||++++.+|+++|+
T Consensus        88 ~~~GC~~~~~~~~~~n~  104 (104)
T cd03161          88 YQQGCFTLVTSFMEANM  104 (104)
T ss_pred             chhccHHHHHHHHHHhC
Confidence            46799999999999874


No 25 
>cd03163 TM4SF8_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), TM4SF8_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This subfamily contaions transmembrane 4 superfamily 8 (TM4SF8) or Tspan-3 and related proteins. Tspan-3 has been reported to form a complex with integrin beta1 and OSP/claudin-11, which may be involved in oligodendrocyte proliferation and migration.
Probab=50.11  E-value=8.8  Score=27.93  Aligned_cols=17  Identities=12%  Similarity=0.006  Sum_probs=15.1

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||++++.+|+++|+
T Consensus        88 ~~~GC~~~~~~~~~~~~  104 (105)
T cd03163          88 YQEGCEAKLVKKLQEVM  104 (105)
T ss_pred             hhhccHHHHHHHHHHHh
Confidence            46799999999999986


No 26 
>cd03154 TM4SF3_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), TM4SF3_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This subfamily contaions transmembrane 4 superfamily 3 (TM4SF3) or D6.1a and related proteins. D6.1a associates with alpha6beta4 integrin and supports cell motility, it has been ascribed a role in tumor progression and metastasis.
Probab=49.94  E-value=12  Score=27.02  Aligned_cols=17  Identities=24%  Similarity=0.327  Sum_probs=14.8

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||.+++.+|+++|+
T Consensus        84 ~~~GC~~~i~~~~~~~~  100 (100)
T cd03154          84 YKEPCISKIKDFLKKNL  100 (100)
T ss_pred             cccccHHHHHHHHHhhC
Confidence            45799999999999885


No 27 
>cd03165 NET-5_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), NET-5_like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This sub-family contains proteins similar to human tetraspan NET-5.
Probab=47.14  E-value=10  Score=27.08  Aligned_cols=17  Identities=18%  Similarity=0.397  Sum_probs=14.8

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||++++.+|+++|+
T Consensus        82 ~~~GC~~~~~~~~~~~~   98 (98)
T cd03165          82 WKTGCYEKVQQWLVDNL   98 (98)
T ss_pred             HHhhhHHHHHHHHHhcC
Confidence            46799999999999874


No 28 
>PF09323 DUF1980:  Domain of unknown function (DUF1980);  InterPro: IPR015402  Members of this occur in gene pairs with members of PF03773 from PFAM. The N-terminal region contains several predicted transmembrane helix regions while the few invariant residues (G, CxxD, and W) occur in the C-terminal region.  Members of this family are found in a set of prokaryotic hypothetical proteins. Their exact function has not, as yet, been defined. 
Probab=46.08  E-value=1.1e+02  Score=24.88  Aligned_cols=29  Identities=3%  Similarity=-0.062  Sum_probs=21.3

Q ss_pred             hhHHHHhHHHHHHHHHHHhhhHHhhhhhh
Q 027714           57 FICSFIGIGVTFCLITCLGHIAAASANGF   85 (220)
Q Consensus        57 ~i~~li~vG~il~~is~lGc~GA~~es~c   85 (220)
                      ..+.++..++++++++++-.....+..+.
T Consensus        31 ~~~~~~~a~i~l~ilai~q~~~~~~~~~~   59 (182)
T PF09323_consen   31 YIPLLYFAAILLLILAIVQLWRWFRPKRR   59 (182)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcccc
Confidence            34567777888888888887777766554


No 29 
>cd03152 CD9_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), CD9 family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD9 is found in virtually all tissues and is potentially involved in developmental processes. It associates with the tetraspanins CD81 and CD63, as well as with some integrin, and has been shown to be involved in a variety of activation, adhesion, and cell motility functions, as well as cell-cell interactions - such as
Probab=45.56  E-value=14  Score=25.97  Aligned_cols=17  Identities=6%  Similarity=-0.019  Sum_probs=14.8

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||++++.+|+++|+
T Consensus        68 ~~~gC~~~i~~~~~~~~   84 (84)
T cd03152          68 ITKSCPDAIDDVFNSKL   84 (84)
T ss_pred             ccCCCcHHHHHHHHccC
Confidence            46699999999999885


No 30 
>PF13903 Claudin_2:  PMP-22/EMP/MP20/Claudin tight junction
Probab=45.25  E-value=1.3e+02  Score=23.20  Aligned_cols=29  Identities=14%  Similarity=0.178  Sum_probs=19.3

Q ss_pred             HHHhHHHHHHHHHHH-hhhHHhhhhhhHHH
Q 027714           60 SFIGIGVTFCLITCL-GHIAAASANGFCLS   88 (220)
Q Consensus        60 ~li~vG~il~~is~l-Gc~GA~~es~c~L~   88 (220)
                      .++.+|+++.+++++ +.++..++++.+..
T Consensus        73 ~~~~l~~~~~~~a~~~~~~~~~~~~~~~~~  102 (172)
T PF13903_consen   73 AFLILGLLLLLFAFVFALIGFCKRSYTLYL  102 (172)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccccchhH
Confidence            456667777777665 77777777764433


No 31 
>cd03160 CD37_CD82_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), CD37_CD82_Like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD37 is a leukocyte-specific protein, and its restricted expression pattern suggests a role in the immune system. A regulatory role in T-cell proliferation has been suggested. CD82 is a metastasis suppressor implicated in biological processes ranging from fusion, adhesion, and migration to apoptos
Probab=44.93  E-value=9.8  Score=28.32  Aligned_cols=17  Identities=12%  Similarity=0.386  Sum_probs=15.0

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||++++.+|+++|+
T Consensus       100 y~~GC~~~l~~~~~~n~  116 (117)
T cd03160         100 YQEGCMEKLQSWLNENL  116 (117)
T ss_pred             HHHhhHHHHHHHHHHhc
Confidence            45799999999999986


No 32 
>cd03159 TM4SF9_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), TM4SF9_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This subfamily contaions transmembrane 4 superfamily 9 (TM4SF9) or Tetraspanin-5 and related proteins. TM4SF9 is strongly expressed witin the central nervous system, and expression levels appear to correlate with differentiation status of particular neurons, hinting at a role in neuronal maturation.
Probab=44.68  E-value=12  Score=28.17  Aligned_cols=17  Identities=24%  Similarity=0.600  Sum_probs=14.9

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||++++.+|+++|+
T Consensus       105 ~~~GC~~~l~~~~~~n~  121 (121)
T cd03159         105 HTKGCVQAFEKWLQDNL  121 (121)
T ss_pred             hHhhCHHHHHHHHHhcC
Confidence            46799999999999985


No 33 
>cd03155 CD151_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), CD151_Like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD151strongly associates with integrins, especially alpha3beta1, alpha6beta1, alpha7beta1, and alpha6beta4; it may play roles in cell-cell adhesion, cell migration, platelet aggregation, and angiogenesis. For example, CD151 is  is involved in regulation of migration of neutrophils, endothelial cells, and 
Probab=44.21  E-value=16  Score=26.66  Aligned_cols=15  Identities=13%  Similarity=0.397  Sum_probs=13.9

Q ss_pred             CChHHHHHHHHHhcc
Q 027714          123 TGRFHDFKKFVKSNF  137 (220)
Q Consensus       123 ~Gc~~~~~~~i~~~~  137 (220)
                      +||.+++.+|+++|+
T Consensus        96 ~GC~~~~~~~~~~~~  110 (110)
T cd03155          96 GGCIPKLEDFLYDHL  110 (110)
T ss_pred             CChHHHHHHHHHHhC
Confidence            899999999999875


No 34 
>PF06724 DUF1206:  Domain of Unknown Function (DUF1206);  InterPro: IPR009597 This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.
Probab=42.11  E-value=32  Score=23.71  Aligned_cols=21  Identities=38%  Similarity=0.881  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHhhhhc
Q 027714           17 NLIMGIVGISMILYGIWMIRV   37 (220)
Q Consensus        17 N~l~~l~Gl~li~~Giw~~~~   37 (220)
                      ..+++++|+.++++|+|...+
T Consensus        47 ~~ll~~vg~gli~~gi~~~~~   67 (73)
T PF06724_consen   47 RWLLGAVGLGLIGYGIWQFVK   67 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            478899999999999998654


No 35 
>PF10176 DUF2370:  Protein of unknown function (DUF2370);  InterPro: IPR019325 Proteins in this family are conserved from fungi to humans. They include the human NEDD4 family-interacting proteins and the yeast BSD2 metal homeostatis proteins. 
Probab=41.62  E-value=37  Score=29.35  Aligned_cols=33  Identities=12%  Similarity=0.310  Sum_probs=28.1

Q ss_pred             CchhhhHHHHhHHHHHHHHHHHhhhHHhhhhhh
Q 027714           53 INPWFICSFIGIGVTFCLITCLGHIAAASANGF   85 (220)
Q Consensus        53 ~~~~~i~~li~vG~il~~is~lGc~GA~~es~c   85 (220)
                      ..+|..|++|++|.++++-|+.+.+=+.|.-+-
T Consensus       192 ~~~wla~~Lm~~G~fI~irsi~dY~rVKR~Er~  224 (233)
T PF10176_consen  192 SNPWLAYILMAFGWFIFIRSIIDYWRVKRMERL  224 (233)
T ss_pred             CCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            346888999999999999999999988776553


No 36 
>PF11127 DUF2892:  Protein of unknown function (DUF2892);  InterPro: IPR021309  This family is conserved in bacteria. The function is not known. 
Probab=41.36  E-value=69  Score=21.45  Aligned_cols=23  Identities=9%  Similarity=0.002  Sum_probs=19.4

Q ss_pred             HHHHhHHHHHHHHHHHhhhHHhh
Q 027714           59 CSFIGIGVTFCLITCLGHIAAAS   81 (220)
Q Consensus        59 ~~li~vG~il~~is~lGc~GA~~   81 (220)
                      +++..+|+.++..++.|+|...+
T Consensus        34 ~~~~~~g~~ll~~g~~g~Cp~~~   56 (66)
T PF11127_consen   34 WLLGFVGAMLLVTGITGFCPLYA   56 (66)
T ss_pred             HHHHHHHHHHHHHHHHCcCHhHH
Confidence            46788999999999999998653


No 37 
>PRK12587 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=39.63  E-value=1.8e+02  Score=22.47  Aligned_cols=32  Identities=19%  Similarity=0.215  Sum_probs=24.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhhcccc
Q 027714            9 LQSFLKALNLIMGIVGISMILYGIWMIRVWQR   40 (220)
Q Consensus         9 lK~lL~~~N~l~~l~Gl~li~~Giw~~~~~~~   40 (220)
                      +|-.+-.+-.++.+.|..+..+|..-+.+..+
T Consensus         2 ~~~~~~~l~~ill~~G~~~~ligaiGllR~PD   33 (118)
T PRK12587          2 IKIILISLALIFVIIGALISALAAIGLLRLED   33 (118)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCc
Confidence            45567778888899999999888887666544


No 38 
>PF11297 DUF3098:  Protein of unknown function (DUF3098);  InterPro: IPR021448  This bacterial family of proteins has no known function. 
Probab=39.44  E-value=67  Score=22.51  Aligned_cols=23  Identities=26%  Similarity=0.437  Sum_probs=20.2

Q ss_pred             HHHHHHHHHHHHHHHHHhhhhcc
Q 027714           16 LNLIMGIVGISMILYGIWMIRVW   38 (220)
Q Consensus        16 ~N~l~~l~Gl~li~~Giw~~~~~   38 (220)
                      -|.++.++|++++..|-+++...
T Consensus         6 ~Nyill~iG~~vIilGfilMsg~   28 (69)
T PF11297_consen    6 KNYILLAIGIAVIILGFILMSGG   28 (69)
T ss_pred             HHHHHHHHHHHHHHHHHHheeCC
Confidence            49999999999999999987643


No 39 
>PF15125 TMEM238:  TMEM238 protein family
Probab=38.38  E-value=1e+02  Score=21.30  Aligned_cols=45  Identities=20%  Similarity=0.313  Sum_probs=31.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhcccccccccccCccCCCchhhhHHHHhHHHHHHHHHHHhhh
Q 027714           14 KALNLIMGIVGISMILYGIWMIRVWQRDMEGQSFDDFCSINPWFICSFIGIGVTFCLITCLGHI   77 (220)
Q Consensus        14 ~~~N~l~~l~Gl~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~i~~li~vG~il~~is~lGc~   77 (220)
                      +.+-.++=++|+.++..|+..-..+.                   =.++=.|+++...|+++.+
T Consensus         7 f~laV~fD~vGl~~Ll~GiFa~l~f~-------------------D~lvY~GaliiflSL~~Wv   51 (65)
T PF15125_consen    7 FWLAVVFDVVGLVMLLTGIFAPLDFY-------------------DFLVYTGALIIFLSLLWWV   51 (65)
T ss_pred             hHHHHHHHHhhHHHHHHHHhcchhHH-------------------HHHHHHhHHHHHHHHHHHH
Confidence            45677788899999999988533211                   1456669999988888754


No 40 
>cd03156 uroplakin_I_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), uroplakin_I_like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". Uroplakin Ia and Ib are components of the 16nm protein particles, which are packed hexagonally to form 2D crystals of asymmetric unit membranes, and cover the apical surface of mammalian urothelium, contributing to the urinay bladder's permeability barrier function. Uroplakins Ia and Ib are ma
Probab=38.07  E-value=20  Score=26.06  Aligned_cols=17  Identities=6%  Similarity=0.229  Sum_probs=14.7

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||++++.+|+++|.
T Consensus        98 ~~~GC~~~l~~~~~~~~  114 (114)
T cd03156          98 NKKGCYEKLSNPIERYA  114 (114)
T ss_pred             hhcCchHHHHHHHHhcC
Confidence            46799999999999873


No 41 
>PF10812 DUF2561:  Protein of unknown function (DUF2561);  InterPro: IPR024381 This family of proteins with unknown function appears to be found predominantly in Mycobacterium spp.
Probab=37.74  E-value=1.2e+02  Score=25.68  Aligned_cols=55  Identities=13%  Similarity=0.201  Sum_probs=30.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhcccccccccccCccCCCchhhhHHHHhHHHHHHH
Q 027714           13 LKALNLIMGIVGISMILYGIWMIRVWQRDMEGQSFDDFCSINPWFICSFIGIGVTFCL   70 (220)
Q Consensus        13 L~~~N~l~~l~Gl~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~i~~li~vG~il~~   70 (220)
                      |.-..-..|+.-+.+-..++-.+.+..+-.+.   +..+..++|.+|..|++.+.+++
T Consensus        24 LlG~CaaiWLa~lG~~VaA~VaL~Dlgrg~~~---~s~ss~T~WvLY~VI~VSaaVIa   78 (207)
T PF10812_consen   24 LLGACAAIWLAALGVSVAATVALVDLGRGFHE---SSGSSGTPWVLYAVIGVSAAVIA   78 (207)
T ss_pred             HHHHHHHHHHHHHHHHHHHhheeecccCCccC---cCCCCCCCEeehHHHHHHHHHHH
Confidence            33344455665555555555556665543221   12234578989988887776644


No 42 
>KOG3950 consensus Gamma/delta sarcoglycan [Cytoskeleton]
Probab=36.17  E-value=53  Score=28.76  Aligned_cols=26  Identities=23%  Similarity=0.429  Sum_probs=22.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhHhh
Q 027714           84 GFCLSFYMLITCLLLLLETAIAADIQ  109 (220)
Q Consensus        84 ~c~L~~Y~~ll~ll~llE~~~~~~~~  109 (220)
                      +.||.+|..++++++++-++..+|+.
T Consensus        34 KrcLY~fvLlL~i~ivvNLalTiWIl   59 (292)
T KOG3950|consen   34 KRCLYTFVLLLMILIVVNLALTIWIL   59 (292)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34689999999999999999999876


No 43 
>cd03127 tetraspanin_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL). Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. The tetraspanin family contains CD9, CD63, CD37, CD53, CD82, CD151, and CD81, amongst others. Tetraspanins are involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, cancer, and others. Their various functions may relate to their ability to act as molecular facilitators, grouping specific cell-surface proteins and affecting formation and stability of signaling complexes. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web", which may also include integr
Probab=34.68  E-value=23  Score=24.36  Aligned_cols=17  Identities=24%  Similarity=0.487  Sum_probs=14.4

Q ss_pred             CCCChHHHHHHHHHhcc
Q 027714          121 DPTGRFHDFKKFVKSNF  137 (220)
Q Consensus       121 ~~~Gc~~~~~~~i~~~~  137 (220)
                      +.+||.+++.+|++++.
T Consensus        74 ~~~GC~~~~~~~~~~~~   90 (90)
T cd03127          74 YTEGCLEKLVDFLRSNL   90 (90)
T ss_pred             hhHccHHHHHHHHHhhC
Confidence            36799999999999863


No 44 
>PRK12586 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=34.18  E-value=2.4e+02  Score=22.54  Aligned_cols=29  Identities=21%  Similarity=0.234  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhcccc
Q 027714           12 FLKALNLIMGIVGISMILYGIWMIRVWQR   40 (220)
Q Consensus        12 lL~~~N~l~~l~Gl~li~~Giw~~~~~~~   40 (220)
                      ++-++-.++.++|..++.+|..-+....+
T Consensus         7 ~~~il~~ill~lG~~f~ligaIGllRfPD   35 (145)
T PRK12586          7 IFSLIAAIMILLGSIIALISAIGIVKFQD   35 (145)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhCCc
Confidence            34556677788888888877776665443


No 45 
>PF11381 DUF3185:  Protein of unknown function (DUF3185);  InterPro: IPR021521  Some members in this bacterial family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known. 
Probab=33.89  E-value=25  Score=23.85  Aligned_cols=55  Identities=9%  Similarity=0.138  Sum_probs=26.7

Q ss_pred             HHHHHHHHHHHHHHHHhhhhcccccccccccCccCCCchhhhHHHHhHHHHHHHHHHHh
Q 027714           17 NLIMGIVGISMILYGIWMIRVWQRDMEGQSFDDFCSINPWFICSFIGIGVTFCLITCLG   75 (220)
Q Consensus        17 N~l~~l~Gl~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~i~~li~vG~il~~is~lG   75 (220)
                      .+++.+.|++++.+|.-......+..... + ....+..  ...+++.|++..++++++
T Consensus         4 gi~Llv~GivLl~~G~~~~~S~~s~~s~~-~-TG~~t~~--t~~~ligG~va~ivGl~~   58 (59)
T PF11381_consen    4 GIALLVGGIVLLYFGYQASDSLGSQVSRA-F-TGSPTDK--TIWYLIGGAVAVIVGLFL   58 (59)
T ss_pred             eehHHHHHHHHHHhhhhhhhhHHHHHHHH-h-cCCCCch--hHHHHHhHHHHHHHHHhh
Confidence            34566777777766654332211111100 0 0111111  124567799988888764


No 46 
>KOG4812 consensus Golgi-associated protein/Nedd4 WW domain-binding protein [General function prediction only]
Probab=32.11  E-value=61  Score=28.31  Aligned_cols=30  Identities=17%  Similarity=0.325  Sum_probs=23.8

Q ss_pred             hhhhHHHHhHHHHHHHHHHHhhhHHhhhhh
Q 027714           55 PWFICSFIGIGVTFCLITCLGHIAAASANG   84 (220)
Q Consensus        55 ~~~i~~li~vG~il~~is~lGc~GA~~es~   84 (220)
                      +|--++++++|.++++.++++.+-.-|-.+
T Consensus       223 ~wLwwi~~vlG~ll~lr~~i~YikVrrm~~  252 (262)
T KOG4812|consen  223 YWLWWIFLVLGLLLFLRGFINYIKVRRMEE  252 (262)
T ss_pred             hHHHHHHHHHHHHHHHHHHHhHHHHhhHHH
Confidence            565578999999999999999876655443


No 47 
>PF04156 IncA:  IncA protein;  InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
Probab=31.89  E-value=2.2e+02  Score=22.93  Aligned_cols=22  Identities=14%  Similarity=0.078  Sum_probs=13.0

Q ss_pred             HHHhHHHHHHHHHHHhhhHHhh
Q 027714           60 SFIGIGVTFCLITCLGHIAAAS   81 (220)
Q Consensus        60 ~li~vG~il~~is~lGc~GA~~   81 (220)
                      +.+++|+++++.|..++.-...
T Consensus        10 ~~iilgilli~~gI~~Lv~~~~   31 (191)
T PF04156_consen   10 ILIILGILLIASGIAALVLFIS   31 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            4566677766666666444433


No 48 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=31.45  E-value=47  Score=25.58  Aligned_cols=7  Identities=57%  Similarity=1.360  Sum_probs=3.2

Q ss_pred             cCCCCcc
Q 027714          172 YDNDGEF  178 (220)
Q Consensus       172 ~d~~d~~  178 (220)
                      ||.+.+|
T Consensus        78 Yd~~g~~   84 (130)
T PF12273_consen   78 YDQQGNF   84 (130)
T ss_pred             CCCCCCC
Confidence            4444444


No 49 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=31.37  E-value=82  Score=18.91  Aligned_cols=24  Identities=13%  Similarity=0.105  Sum_probs=19.8

Q ss_pred             HHHHhHHHHHHHHHHHhhhHHhhh
Q 027714           59 CSFIGIGVTFCLITCLGHIAAASA   82 (220)
Q Consensus        59 ~~li~vG~il~~is~lGc~GA~~e   82 (220)
                      |+-+++|.+++++++-|.....++
T Consensus        10 W~Gl~~g~~l~~~~~tG~~~~f~~   33 (37)
T PF13706_consen   10 WLGLILGLLLFVIFLTGAVMVFRD   33 (37)
T ss_pred             HHHHHHHHHHHHHHHHhHHHHHHH
Confidence            577889999999999998876643


No 50 
>COG4993 Gcd Glucose dehydrogenase [Carbohydrate transport and metabolism]
Probab=30.17  E-value=1.3e+02  Score=29.94  Aligned_cols=63  Identities=19%  Similarity=0.419  Sum_probs=41.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhcccccccccccCccCCCchhhhHHHHhHHHHHHHHHHHhhhHHhhhhhhHHHHHHH
Q 027714           13 LKALNLIMGIVGISMILYGIWMIRVWQRDMEGQSFDDFCSINPWFICSFIGIGVTFCLITCLGHIAAASANGFCLSFYML   92 (220)
Q Consensus        13 L~~~N~l~~l~Gl~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~i~~li~vG~il~~is~lGc~GA~~es~c~L~~Y~~   92 (220)
                      +.+..+++.++|+++.+-|+|+..-               .-.|  |. +..|..+++.+++=    .++++--|..|..
T Consensus         3 ~~~~~~~~~~~gl~l~~gg~~l~~l---------------ggs~--yy-~iagl~~l~~~~ll----~~~k~aal~lya~   60 (773)
T COG4993           3 VTLTALVIALCGLALLIGGIWLVAL---------------GGSW--YY-LIAGLVLLLSAWLL----LRRKRAALWLYAL   60 (773)
T ss_pred             hhHHHHHHHHHHHHHhccceeEEee---------------CCch--HH-HHHHHHHHHHHHHH----hccchhHHHHHHH
Confidence            3456678889999999888885321               1112  22 44577777777663    4778888998886


Q ss_pred             HHHHH
Q 027714           93 ITCLL   97 (220)
Q Consensus        93 ll~ll   97 (220)
                      +++.-
T Consensus        61 ~~~~t   65 (773)
T COG4993          61 VLLGT   65 (773)
T ss_pred             HHHHH
Confidence            65443


No 51 
>PF10731 Anophelin:  Thrombin inhibitor from mosquito;  InterPro: IPR018932  Members of this family are all inhibitors of thrombin, the peptidase that is at the end of the blood coagulation cascade and which creates the clot by cleaving fibrinogen. The interaction between thrombin and fibrinogen involves two different areas of contact - via the thrombin active site and via a second substrate-binding site known as an exosite. The inhibitor acts by blocking the exosite, rather than by interacting with the active site. The inhibitors are from mosquitoes that feed on human blood and which, by inhibiting thrombin, prevent the blood from clotting and keep it flowing. 
Probab=29.57  E-value=93  Score=21.26  Aligned_cols=26  Identities=19%  Similarity=0.314  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHhhcc---CCCCccCCCCc
Q 027714          152 VSSALLAMALRALGS---NQGYSYDNDGE  177 (220)
Q Consensus       152 ~l~~ilA~~L~~~~~---~~~~~~d~~d~  177 (220)
                      ++++.|.-+.++.-.   .....||+||+
T Consensus        10 lLC~aLva~vQ~APQYa~GeeP~YDEdd~   38 (65)
T PF10731_consen   10 LLCVALVAIVQSAPQYAPGEEPSYDEDDD   38 (65)
T ss_pred             HHHHHHHHHHhcCcccCCCCCCCcCcccC
Confidence            344444444444421   23334887773


No 52 
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=28.43  E-value=46  Score=33.75  Aligned_cols=26  Identities=12%  Similarity=-0.114  Sum_probs=12.9

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhHhhc
Q 027714           85 FCLSFYMLITCLLLLLETAIAADIQL  110 (220)
Q Consensus        85 c~L~~Y~~ll~ll~llE~~~~~~~~~  110 (220)
                      |-=.+|.++++++.+.-++..+.+|.
T Consensus       137 c~R~~l~~~L~~~~~~il~g~i~aF~  162 (806)
T PF05478_consen  137 CRRGCLGILLLLLTLIILFGVICAFV  162 (806)
T ss_pred             cchHHHHHHHHHHHHHHHHHHHHHHH
Confidence            43445555555555554444444554


No 53 
>COG4298 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.19  E-value=1.9e+02  Score=21.15  Aligned_cols=20  Identities=25%  Similarity=0.343  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHHHHhh
Q 027714           15 ALNLIMGIVGISMILYGIWM   34 (220)
Q Consensus        15 ~~N~l~~l~Gl~li~~Giw~   34 (220)
                      .||-.-+-++..|+++|+|.
T Consensus        18 ~f~waafg~s~~m~~~gi~~   37 (95)
T COG4298          18 MFNWAAFGASYFMLGLGIWL   37 (95)
T ss_pred             hHHHHHHHHHHHHHHHHhhe
Confidence            45666666777788888884


No 54 
>PRK11901 hypothetical protein; Reviewed
Probab=27.76  E-value=55  Score=29.71  Aligned_cols=24  Identities=25%  Similarity=0.349  Sum_probs=19.2

Q ss_pred             HHHHhHHHHHHHHHHHhhhHHhhh
Q 027714           59 CSFIGIGVTFCLITCLGHIAAASA   82 (220)
Q Consensus        59 ~~li~vG~il~~is~lGc~GA~~e   82 (220)
                      +++|++|++++++-++|.-.|.|.
T Consensus        37 h~MiGiGilVLlLLIi~IgSALks   60 (327)
T PRK11901         37 HMMIGIGILVLLLLIIAIGSALKS   60 (327)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhccC
Confidence            689999999888887777666653


No 55 
>KOG3658 consensus Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases [Extracellular structures]
Probab=27.40  E-value=88  Score=31.28  Aligned_cols=25  Identities=20%  Similarity=0.368  Sum_probs=15.0

Q ss_pred             HHHHHHHHhccchhhhHHHHHHHHH
Q 027714          127 HDFKKFVKSNFDIFKWIGIWIISAQ  151 (220)
Q Consensus       127 ~~~~~~i~~~~~i~~~v~i~v~~~q  151 (220)
                      +.+.+|++.||.....++++++++-
T Consensus       673 ~~~~~w~~~~w~~v~i~gi~~i~~m  697 (764)
T KOG3658|consen  673 ETFAEWIVLNWLAVNIVGIVLIVLM  697 (764)
T ss_pred             hhhHHHHHhhhHHhHhHHHHHHHHH
Confidence            4455666777766666666554433


No 56 
>PRK07946 putative monovalent cation/H+ antiporter subunit C; Reviewed
Probab=26.77  E-value=89  Score=25.58  Aligned_cols=22  Identities=14%  Similarity=0.107  Sum_probs=17.5

Q ss_pred             HHHHHHHHHHHHHHHHHhhhhc
Q 027714           16 LNLIMGIVGISMILYGIWMIRV   37 (220)
Q Consensus        16 ~N~l~~l~Gl~li~~Giw~~~~   37 (220)
                      .|++..++..++++.|+|++.+
T Consensus         3 ~~l~~~i~~gvL~~~G~Ylll~   24 (163)
T PRK07946          3 ANLGLLVAIGVLTSAGVYLLLE   24 (163)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhh
Confidence            4667777888889999998874


No 57 
>PF10177 DUF2371:  Uncharacterised conserved protein (DUF2371);  InterPro: IPR018787  This family of proteins with no known function is conserved from nematodes to humans. It includes members of the TMEM200 family of transmembrane proteins. 
Probab=26.30  E-value=44  Score=26.66  Aligned_cols=24  Identities=29%  Similarity=0.649  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhh
Q 027714           12 FLKALNLIMGIVGISMILYGIWMI   35 (220)
Q Consensus        12 lL~~~N~l~~l~Gl~li~~Giw~~   35 (220)
                      +..++-++..++|++|-.+|-|-.
T Consensus        41 ~~l~lG~lvllvGiaMAv~GYwp~   64 (141)
T PF10177_consen   41 LFLLLGILVLLVGIAMAVLGYWPK   64 (141)
T ss_pred             HHHHHHHHHHHHhhHhheeecccc
Confidence            445556677777887777777765


No 58 
>PRK02935 hypothetical protein; Provisional
Probab=25.83  E-value=3e+02  Score=20.95  Aligned_cols=38  Identities=16%  Similarity=0.259  Sum_probs=26.3

Q ss_pred             HHHHhHHHHHHHHHHHhhhHHhhhhhhHHHHHHHHHHHHHHHH
Q 027714           59 CSFIGIGVTFCLITCLGHIAAASANGFCLSFYMLITCLLLLLE  101 (220)
Q Consensus        59 ~~li~vG~il~~is~lGc~GA~~es~c~L~~Y~~ll~ll~llE  101 (220)
                      -.++-+|.+++.+|++=     +++.....+|+++-++.++.-
T Consensus        17 L~lvfiG~~vMy~Giff-----~~~~~~m~ifm~~G~l~~l~S   54 (110)
T PRK02935         17 LSLVFIGFIVMYLGIFF-----RESIIIMTIFMLLGFLAVIAS   54 (110)
T ss_pred             HHHHHHHHHHHHHHHHh-----cccHHHHHHHHHHHHHHHHHH
Confidence            35677888888888542     788887777777666655543


No 59 
>PRK06654 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=24.42  E-value=1.1e+02  Score=25.55  Aligned_cols=27  Identities=11%  Similarity=0.391  Sum_probs=17.0

Q ss_pred             chhhhHHHHHHHHHHHHHHHHHHHHhh
Q 027714          138 DIFKWIGIWIISAQVSSALLAMALRAL  164 (220)
Q Consensus       138 ~i~~~v~i~v~~~q~l~~ilA~~L~~~  164 (220)
                      ++.+|++++++.+-.++.+.+.+=.+.
T Consensus        32 k~l~~~~i~~~a~i~i~~v~~~~~~~~   58 (181)
T PRK06654         32 KILQWVAIGLFAVIFIVTVVYFVSKMV   58 (181)
T ss_pred             HHHHHHHHHHHHHHHHhhhhhhhhhhh
Confidence            356888888877766666654443333


No 60 
>PF11014 DUF2852:  Protein of unknown function (DUF2852);  InterPro: IPR021273  This bacterial family of proteins has no known function. 
Probab=24.09  E-value=77  Score=24.42  Aligned_cols=17  Identities=24%  Similarity=0.718  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHHhh
Q 027714           18 LIMGIVGISMILYGIWM   34 (220)
Q Consensus        18 ~l~~l~Gl~li~~Giw~   34 (220)
                      ++||=+|+++++|.+|-
T Consensus        20 i~fWPlGla~Lay~iw~   36 (115)
T PF11014_consen   20 IVFWPLGLALLAYMIWG   36 (115)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            35889999999999996


No 61 
>PF11359 gpUL132:  Glycoprotein UL132;  InterPro: IPR021023  Glycoprotein UL132 is a low-abundance structural component of Human herpesvirus 5 []. The function of this protein is not fully understood. 
Probab=24.02  E-value=2.1e+02  Score=24.60  Aligned_cols=27  Identities=7%  Similarity=-0.062  Sum_probs=16.1

Q ss_pred             hccchhhhHHHHHHHHHHHHHHHHHHH
Q 027714          135 SNFDIFKWIGIWIISAQVSSALLAMAL  161 (220)
Q Consensus       135 ~~~~i~~~v~i~v~~~q~l~~ilA~~L  161 (220)
                      +-+.++.-+..++.+++++....+-.+
T Consensus        49 kvL~IliYcVTg~sllsli~VtvaalY   75 (235)
T PF11359_consen   49 KVLAILIYCVTGFSLLSLIVVTVAALY   75 (235)
T ss_pred             HHHhhheeeehhHHHHHHHHHHHHHHH
Confidence            334445555666777787766665544


No 62 
>PF08611 DUF1774:  Fungal protein of unknown function (DUF1774);  InterPro: IPR013920  This is a fungal protein of unknown function. 
Probab=23.96  E-value=2.1e+02  Score=21.36  Aligned_cols=8  Identities=50%  Similarity=1.007  Sum_probs=6.5

Q ss_pred             cccccccc
Q 027714          180 SDRLPLIN  187 (220)
Q Consensus       180 ~~r~pl~~  187 (220)
                      .+|.||||
T Consensus        90 ~EraPLLn   97 (97)
T PF08611_consen   90 RERAPLLN   97 (97)
T ss_pred             cccccccC
Confidence            46999997


No 63 
>PF12805 FUSC-like:  FUSC-like inner membrane protein yccS
Probab=23.62  E-value=4.5e+02  Score=22.71  Aligned_cols=21  Identities=10%  Similarity=0.134  Sum_probs=13.4

Q ss_pred             HHHhHHHHHHHHHHHhhhHHh
Q 027714           60 SFIGIGVTFCLITCLGHIAAA   80 (220)
Q Consensus        60 ~li~vG~il~~is~lGc~GA~   80 (220)
                      +.++++++.|+.+++|-.|.-
T Consensus        26 ~~~~~~~~~F~~~ml~~~G~r   46 (284)
T PF12805_consen   26 LILVLALLTFFFGMLGVYGPR   46 (284)
T ss_pred             HHHHHHHHHHHHHHHHHHhhH
Confidence            445566666777777777653


No 64 
>PF10873 DUF2668:  Protein of unknown function (DUF2668);  InterPro: IPR022640  Members in this family of proteins are annotated as cysteine and tyrosine-rich protein 1, however currently no function is known []. 
Probab=23.40  E-value=4e+02  Score=21.50  Aligned_cols=20  Identities=10%  Similarity=0.077  Sum_probs=9.1

Q ss_pred             HHHHhccc--hhhhHHHHHHHH
Q 027714          131 KFVKSNFD--IFKWIGIWIISA  150 (220)
Q Consensus       131 ~~i~~~~~--i~~~v~i~v~~~  150 (220)
                      +++++-+.  .+.++..+++++
T Consensus        52 ~yi~~~lsgtAIaGIVfgiVfi   73 (155)
T PF10873_consen   52 AYIGDVLSGTAIAGIVFGIVFI   73 (155)
T ss_pred             hhhccccccceeeeeehhhHHH
Confidence            56665554  233333344333


No 65 
>PRK12585 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=20.99  E-value=1e+02  Score=25.90  Aligned_cols=21  Identities=29%  Similarity=0.488  Sum_probs=16.4

Q ss_pred             hhHHHHhHHHHHHHHHHHhhh
Q 027714           57 FICSFIGIGVTFCLITCLGHI   77 (220)
Q Consensus        57 ~i~~li~vG~il~~is~lGc~   77 (220)
                      .+.+++.+|++++++|.+|..
T Consensus         8 I~~vLLliG~~f~ligaIGLl   28 (197)
T PRK12585          8 IISIMILIGGLLSILAAIGVI   28 (197)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            346788889999998888753


No 66 
>PHA03283 envelope glycoprotein E; Provisional
Probab=20.94  E-value=1.9e+02  Score=28.05  Aligned_cols=8  Identities=38%  Similarity=0.488  Sum_probs=4.6

Q ss_pred             cCCCCccc
Q 027714          172 YDNDGEFL  179 (220)
Q Consensus       172 ~d~~d~~~  179 (220)
                      +||||+|.
T Consensus       461 ~~~ddsf~  468 (542)
T PHA03283        461 SDSDDSFD  468 (542)
T ss_pred             cCcccccc
Confidence            45666664


No 67 
>PRK15033 tricarballylate utilization protein B; Provisional
Probab=20.57  E-value=6.7e+02  Score=23.44  Aligned_cols=14  Identities=29%  Similarity=0.589  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHH
Q 027714           18 LIMGIVGISMILYG   31 (220)
Q Consensus        18 ~l~~l~Gl~li~~G   31 (220)
                      -+++.+|..++.+|
T Consensus       275 klLg~vGgi~LliG  288 (389)
T PRK15033        275 VLLGTLGGIGLLIG  288 (389)
T ss_pred             HHHHHHHHHHHHHH
Confidence            35666777777776


No 68 
>PF13314 DUF4083:  Domain of unknown function (DUF4083)
Probab=20.22  E-value=1.6e+02  Score=19.92  Aligned_cols=30  Identities=13%  Similarity=0.076  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHHHhhccCCCCccCCCCc
Q 027714          148 ISAQVSSALLAMALRALGSNQGYSYDNDGE  177 (220)
Q Consensus       148 ~~~q~l~~ilA~~L~~~~~~~~~~~d~~d~  177 (220)
                      .++-++++.|+.+.|++..+....+.++++
T Consensus        14 ~l~vl~~~~Ftl~IRri~~~s~~kkq~~~~   43 (58)
T PF13314_consen   14 ILIVLFGASFTLFIRRILINSNAKKQDVDS   43 (58)
T ss_pred             HHHHHHHHHHHHHHHHHHHhccccccchhH
Confidence            334456777887888887665555544443


Done!