Citrus Sinensis ID: 027749


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MAAATAMRRRGGGGGMDDDKMVFETTEGVEAITSFDAMGIKDDLLRGIYQYGFEKPSAIQQRAVMPIIKGRDVIAQAQSGTGKTSMIALTVCQTVDTSSREVQALILSPTRELATQTEKVILAIGDFINIQAHACVGGKSVGEDIRKLEHGVHVVSGTPGRVCDMIKRKTLRTRAIKLLVLDESDEMLSRGFKDQIYDVYRYLPPDLQVCCPGSCFLFD
ccHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHHcccccCEEEECccccHHHHHHHHcccccEEEEccHHHHHHHcccccccccccEEEEEccHHHcccccHHHHHHHHHccccccEEEEEECccccc
***********************ETTEGVEAITSFDAMGIKDDLLRGIYQYGFEKPSAIQQRAVMPIIKGRDVIAQAQSGTGKTSMIALTVCQTVDTSSREVQALILSPTRELATQTEKVILAIGDFINIQAHACVGGKSVGEDIRKLEHGVHVVSGTPGRVCDMIKRKTLRTRAIKLLVLDESDEMLSRGFKDQIYDVYRYLPPDLQVCCPGSCFLF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAATAMRRRGGGGGMDDDKMVFETTEGVEAITSFDAMGIKDDLLRGIYQYGFEKPSAIQQRAVMPIIKGRDVIAQAQSGTGKTSMIALTVCQTVDTSSREVQALILSPTRELATQTEKVILAIGDFINIQAHACVGGKSVGEDIRKLEHGVHVVSGTPGRVCDMIKRKTLRTRAIKLLVLDESDEMLSRGFKDQIYDVYRYLPPDLQVCCPGSCFLFD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DEAD-box ATP-dependent RNA helicase 34 ATP-dependent RNA helicase involved in 40S ribosomal subunit biogenesis. Required for the processing and cleavage of 35S pre-rRNA at sites A0, A1, and A2, leading to mature 18S rRNA.probableQ10I26
DEAD-box ATP-dependent RNA helicase 2 ATP-dependent RNA helicase involved in 40S ribosomal subunit biogenesis. Required for the processing and cleavage of 35S pre-rRNA at sites A0, A1, and A2, leading to mature 18S rRNA.probableQ5VNM3
DEAD-box ATP-dependent RNA helicase 2 ATP-dependent RNA helicase involved in 40S ribosomal subunit biogenesis. Required for the processing and cleavage of 35S pre-rRNA at sites A0, A1, and A2, leading to mature 18S rRNA.probableQ94A52

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.13RNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BOR, chain A
Confidence level:very confident
Coverage over the Query: 30-137,151-218
View the alignment between query and template
View the model in PyMOL