BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 027761
(219 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4AM6|A Chain A, C-terminal Domain Of Actin-related Protein Arp8 From S.
Cerevisiae
pdb|4AM6|B Chain B, C-terminal Domain Of Actin-related Protein Arp8 From S.
Cerevisiae
pdb|4AM7|A Chain A, Adp-bound C-terminal Domain Of Actin-related Protein Arp8
From S. Cerevisiae
pdb|4AM7|B Chain B, Adp-bound C-terminal Domain Of Actin-related Protein Arp8
From S. Cerevisiae
Length = 655
Score = 27.7 bits (60), Expect = 5.4, Method: Compositional matrix adjust.
Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%)
Query: 121 LMDAFQLKDQLLDKFNAQGHFPNQCQENELSTLKCLVNFIVVISLTAIFTYLTLFSS 177
++DA + DQL DK G N +EN K +V I S+TA T + F S
Sbjct: 449 ILDAHNIIDQLQDKPENYG---NTLKENFAPLEKAIVQSIANASITADVTRMNSFYS 502
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.139 0.442
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,129,786
Number of Sequences: 62578
Number of extensions: 227666
Number of successful extensions: 499
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 499
Number of HSP's gapped (non-prelim): 1
length of query: 219
length of database: 14,973,337
effective HSP length: 95
effective length of query: 124
effective length of database: 9,028,427
effective search space: 1119524948
effective search space used: 1119524948
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 49 (23.5 bits)