BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027767
         (219 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3C7T|A Chain A, Crystal Structure Of The Ecdysone Phosphate Phosphatase,
           Eppase, From Bombix Mori In Complex With Tungstate
 pdb|3C7T|B Chain B, Crystal Structure Of The Ecdysone Phosphate Phosphatase,
           Eppase, From Bombix Mori In Complex With Tungstate
 pdb|3C7T|C Chain C, Crystal Structure Of The Ecdysone Phosphate Phosphatase,
           Eppase, From Bombix Mori In Complex With Tungstate
 pdb|3C7T|D Chain D, Crystal Structure Of The Ecdysone Phosphate Phosphatase,
           Eppase, From Bombix Mori In Complex With Tungstate
          Length = 263

 Score = 33.1 bits (74), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 6/91 (6%)

Query: 17  DAHLSPLGWQQVGNLRKRVEASGLTQKIDLVITSPLLRTLQTAVGVFGGDGESQTDGIDA 76
           D  L+ LGW Q   + + +  +G++  I  V  SP LR ++TA G   G     +  I  
Sbjct: 57  DTPLTRLGWFQAQLVGEGMRMAGVS--IKHVYASPALRCVETAQGFLDGLRADPSVKIKV 114

Query: 77  HPSLTATATVNCPPII----AVELCRERLGV 103
            P L      + P  I     +ELC+  L V
Sbjct: 115 EPGLFEFKNWHMPKGIDFMTPIELCKAGLNV 145


>pdb|3RCY|A Chain A, Crystal Structure Of Mandelate RacemaseMUCONATE
          LACTONIZING ENZYME- Like Protein From Roseovarius Sp.
          Tm1035
 pdb|3RCY|B Chain B, Crystal Structure Of Mandelate RacemaseMUCONATE
          LACTONIZING ENZYME- Like Protein From Roseovarius Sp.
          Tm1035
 pdb|3RCY|C Chain C, Crystal Structure Of Mandelate RacemaseMUCONATE
          LACTONIZING ENZYME- Like Protein From Roseovarius Sp.
          Tm1035
 pdb|3RCY|D Chain D, Crystal Structure Of Mandelate RacemaseMUCONATE
          LACTONIZING ENZYME- Like Protein From Roseovarius Sp.
          Tm1035
 pdb|3RCY|E Chain E, Crystal Structure Of Mandelate RacemaseMUCONATE
          LACTONIZING ENZYME- Like Protein From Roseovarius Sp.
          Tm1035
 pdb|3RCY|F Chain F, Crystal Structure Of Mandelate RacemaseMUCONATE
          LACTONIZING ENZYME- Like Protein From Roseovarius Sp.
          Tm1035
 pdb|3RCY|G Chain G, Crystal Structure Of Mandelate RacemaseMUCONATE
          LACTONIZING ENZYME- Like Protein From Roseovarius Sp.
          Tm1035
 pdb|3RCY|H Chain H, Crystal Structure Of Mandelate RacemaseMUCONATE
          LACTONIZING ENZYME- Like Protein From Roseovarius Sp.
          Tm1035
          Length = 433

 Score = 28.5 bits (62), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 13/62 (20%)

Query: 6  GPEALLS--QEFFDAHLSPLGWQQVGNLRKRVEASGLTQKIDLVITSPLLRTLQTAVGVF 63
          GPEA+ +  ++ F  H+     + +  + +RV +SG TQ+ DL           TA+G F
Sbjct: 47 GPEAMRAVIEDVFARHMEGENPENIELMFRRVYSSGFTQRPDL-----------TAIGAF 95

Query: 64 GG 65
           G
Sbjct: 96 SG 97


>pdb|2L82|A Chain A, Solution Nmr Structure Of De Novo Designed Protein, P-Loop
           Ntpase Fold, Northeast Structural Genomics Consortium
           Target Or32
          Length = 162

 Score = 27.7 bits (60), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 107 DKRRSISEYHSLFPAIDFKLIESEDDKLWKADAREPFEEVTARGME 152
           D R +I E    +P +D  +I + DDK W  D     EE   RG+E
Sbjct: 63  DFRENIREIWERYPQLDVVVIVTTDDKEWIKDF---IEEAKERGVE 105


>pdb|3F2I|A Chain A, Crystal Structure Of The Alr0221 Protein From Nostoc,
          Northeast Structural Genomics Consortium Target Nsr422.
 pdb|3F2I|B Chain B, Crystal Structure Of The Alr0221 Protein From Nostoc,
          Northeast Structural Genomics Consortium Target Nsr422.
 pdb|3F2I|C Chain C, Crystal Structure Of The Alr0221 Protein From Nostoc,
          Northeast Structural Genomics Consortium Target Nsr422.
 pdb|3F2I|D Chain D, Crystal Structure Of The Alr0221 Protein From Nostoc,
          Northeast Structural Genomics Consortium Target Nsr422.
 pdb|3F2I|E Chain E, Crystal Structure Of The Alr0221 Protein From Nostoc,
          Northeast Structural Genomics Consortium Target Nsr422.
 pdb|3F2I|F Chain F, Crystal Structure Of The Alr0221 Protein From Nostoc,
          Northeast Structural Genomics Consortium Target Nsr422
          Length = 172

 Score = 27.3 bits (59), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%)

Query: 40 LTQKIDLVITSPLLRTLQTA 59
          L ++ DL++TSPL+R  QTA
Sbjct: 43 LGRQFDLIVTSPLIRARQTA 62


>pdb|2KE5|A Chain A, Solution Structure And Dynamics Of The Small Gtpase Ralb
          In Its Active Conformation: Significance For Effector
          Protein Binding
          Length = 174

 Score = 27.3 bits (59), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 1/83 (1%)

Query: 3  GNNGPEALLSQEFFDAHLSPLGWQQVGNLRKRVEASGLTQKIDLVITSPLLRTLQTAVGV 62
          G  G  AL  Q  +D  +      +  + RK+V   G   +ID++ T+ L          
Sbjct: 12 GGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGLEDYAAIRDNY 71

Query: 63 F-GGDGESQTDGIDAHPSLTATA 84
          F  G+G      I  H S TATA
Sbjct: 72 FRSGEGFLLVFSITEHESFTATA 94


>pdb|2KWI|A Chain A, Ralb-Rlip76 (Ralbp1) Complex
          Length = 178

 Score = 26.9 bits (58), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 1/83 (1%)

Query: 3  GNNGPEALLSQEFFDAHLSPLGWQQVGNLRKRVEASGLTQKIDLVITSPLLRTLQTAVGV 62
          G  G  AL  Q  +D  +      +  + RK+V   G   +ID++ T+ L          
Sbjct: 16 GGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGLEDYAAIRDNY 75

Query: 63 F-GGDGESQTDGIDAHPSLTATA 84
          F  G+G      I  H S TATA
Sbjct: 76 FRSGEGFLLVFSITEHESFTATA 98


>pdb|4F5N|A Chain A, Open Ternary Complex Of R283k Dna Polymerase Beta With A
           Metal Free Dctp Analog
 pdb|4F5O|A Chain A, Open Ternary Complex Of R283k Dna Polymerase Beta With A
           One Metal Bound Dctp Analog
 pdb|4F5P|A Chain A, Open Ternary Mismatch Complex Of R283k Dna Polymerase Beta
           With A Datp Analog
 pdb|4F5Q|A Chain A, Closed Ternary Complex Of R283k Dna Polymerase Beta
 pdb|4F5R|A Chain A, Open And Closed Ternary Complex Of R283k Dna Polymerase
           Beta With A Dctp Analog In The Same Asymmetric Unit
 pdb|4F5R|B Chain B, Open And Closed Ternary Complex Of R283k Dna Polymerase
           Beta With A Dctp Analog In The Same Asymmetric Unit
 pdb|4GXI|A Chain A, R283k Dna Polymerase Beta Binary Complex With A Templating
           8og
 pdb|4GXJ|A Chain A, R283k Dna Polymerase Beta Ternary Complex With A
           Templating 8og And Incoming Dctp Analog
 pdb|4GXK|A Chain A, R283k Dna Polymerase Beta Ternary Complex With A
           Templating 8og And Incoming Datp Analog
          Length = 335

 Score = 26.9 bits (58), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 30/72 (41%), Gaps = 5/72 (6%)

Query: 19  HLSPLGWQQVGNLRKRVEASGLTQKIDLVITSPLL---RTLQTAVGVF--GGDGESQTDG 73
           H   +G +  G+  KR+    + Q  D+V+          + T  G F  G +     D 
Sbjct: 134 HHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDV 193

Query: 74  IDAHPSLTATAT 85
           +  HPS T+ +T
Sbjct: 194 LLTHPSFTSEST 205


>pdb|9ICG|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Dctp
           (1 Millimolar) And Zncl2 (1 Millimolar)
 pdb|9ICH|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Dgtp
           (1 Millimolar) And Zncl2 (1 Millimolar)
 pdb|9ICI|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Dttp
           (1 Millimolar) And Zncl2 (1 Millimolar)
 pdb|9ICJ|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna
 pdb|9ICK|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX, SOAKED IN
           The Presence Of Artificial Mother Liquor
 pdb|9ICL|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX, SOAKED IN
           The Presence Of Pyrophosphate And Mncl2
 pdb|9ICM|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Six Base Pairs Of Double Stranded Dna (No 5'-Phosphate)
 pdb|9ICN|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX + 2',3'-
           Dideoxycytidine-5'-Triphosphate, Soaked In The Presence
           Of Ddctp And Mgcl2
 pdb|9ICO|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX, SOAKED IN
           The Presence Of Dttp And Mgcl2
 pdb|9ICP|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Soaked In The Presence Of
           Pyrophosphate (1 Millimolar) And Mgcl2 (5 Millimolar)
 pdb|9ICQ|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Soaked In The Presence Of Datp (1
           Millimolar) And Mncl2 (5 Millimolar)
 pdb|9ICR|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX + 2'-
           Deoxycytidine-5'-Triphosphate, Soaked In The Presence Of
           Dctp And Mncl2
 pdb|9ICS|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX + 2',3'-
           Dideoxycytidine-5'-Triphosphate, Soaked In The Presence
           Of Ddctp And Mncl2
 pdb|9ICT|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX + 2'-
           Deoxyguanosine-5'-Triphosphate, Soaked In The Presence
           Of Dgtp And Mncl2
 pdb|9ICU|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Soaked In The Presence Of Dttp (1
           Millimolar) And Mncl2 (5 Millimolar)
 pdb|9ICV|A Chain A, Dna Polymerase Beta (e.c.2.7.7.7)/dna Complex + 2'-
           Deoxyadenosine-5'-triphosphate, Soaked In The Presence
           Of Datp And Zncl2
 pdb|9ICW|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Native Structure
 pdb|9ICX|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Six Base Pairs Of Dna (non Gapped Dna Only)
 pdb|9ICY|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7) Complexed With Seven
           Base Pairs Of Dna (Non Gapped Dna Only)
 pdb|8ICB|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of
           Artificial Mother Liquor
 pdb|8ICC|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna (no 5'-phosphate)
 pdb|8ICE|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Datp
           (1 Millimolar) And Cdcl2 (1 Millimolar)
 pdb|8ICF|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Datp
           (10 Millimolar) And Mgcl2 (50 Millimolar)
 pdb|8ICG|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Datp
           (1 Millimolar) And Mgcl2 (5 Millimolar)
 pdb|8ICH|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Dctp
           (1 Millimolar) And Mgcl2 (5 Millimolar)
 pdb|8ICI|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Dgtp
           (1 Millimolar) And Mgcl2 (5 Millimolar)
 pdb|8ICJ|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX + THYMIDINE-
           5'-Triphosphate, Soaked In The Presence Of Dttp And
           Mgcl2
 pdb|8ICK|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Datp
           (1 Millimolar), Mgcl2 (5 Millimolar), And Mncl2 (5
           Millimolar)
 pdb|8ICL|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Datp
           (1 Millimolar) And Nicl2 (5 Millimolar)
 pdb|8ICM|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Datp
           (1 Millimolar), Mncl2 (5 Millimolar), And Ammonium
           Sulfate (75 Millimolar)
 pdb|8ICN|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Atp
           (1 Millimolar) And Mncl2 (5 Millimolar)
 pdb|8ICO|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of
           Azt-Tp (1 Millimolar) And Mncl2 (5 Millimolar)
 pdb|8ICP|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Datp
           (1 Millimolar) And Mncl2 (5 Millimolar)
 pdb|8ICQ|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Of
           Datp (0.1 Millimolar) And Mncl2 (0.5 Millimolar)
 pdb|8ICR|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Datp
           (1 Millimolar) And Mncl2 (5 Millimolar)
 pdb|8ICS|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Dctp
           (1 Millimolar) And Mncl2 (5 Millimolar)
 pdb|8ICT|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Dctp
           (1 Millimolar) And Mncl2 (5 Millimolar)
 pdb|8ICU|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Ddatp
           (1 Millimolar) And Mncl2 (5 Millimolar)
 pdb|8ICV|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Dgtp
           (1 Millimolar) And Mncl2 (5 Millimolar)
 pdb|8ICW|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Dttp
           (1 Millimolar) And Mncl2 (5 Millimolar)
 pdb|8ICX|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Dttp
           (1 Millimolar) And Mncl2 (5 Millimolar)
 pdb|8ICY|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX + THYMIDINE-
           5'-Triphosphate, Soaked In The Presence Of Dttp And
           Mncl2
 pdb|8ICZ|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Of
           Datp (1 Millimolar), Mncl2 (5 Millimolar), And Lithium
           Sulfate (75 Millimolar)
 pdb|9ICA|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX + 2'-
           Deoxyadenosine-5'-O-(1-Thiotriphosphate), Soaked In The
           Presence Of Datp(Alpha)s And Mncl2
 pdb|9ICB|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX + 2'-
           Deoxyadenosine-5'-Triphosphate, Soaked In The Presence
           Of Datp And Cocl2
 pdb|9ICC|A Chain A, Dna Polymerase Beta (e.c.2.7.7.7)/dna Complex + 2'-
           Deoxyadenosine-5'-triphosphate, Soaked In The Presence
           Of Datp And Crcl3
 pdb|9ICE|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Datp
           (1 Millimolar) And Cucl2 (0.1 Millimolar)
 pdb|9ICF|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX + 2'-
           Deoxyadenosine-5'-Triphosphate, Soaked In The Presence
           Of Datp And Zncl2
 pdb|1ZQQ|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Mncl2
           (15 Millimolar) And Nacl (15 Millimolar)
 pdb|1ZQR|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX, SOAKED IN
           The Presence Of Nicl2
 pdb|1ZQS|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Tlcl
           (0.5 Millimolar)
 pdb|1ZQT|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Datp
           (0.01 Millimolar) And Zncl2 (0.02 Millimolar)
 pdb|7ICE|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX, SOAKED IN
           The Presence Of Cacl2
 pdb|7ICF|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Soaked In The Presence Of Cdcl2
           (0.1 Millimolar) (Four-Day Soak)
 pdb|7ICG|A Chain A, Dna Polymerase Beta (e.c.2.7.7.7)/dna Complex, Soaked In
           The Presence Of Cdcl2
 pdb|7ICH|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX, SOAKED IN
           The Presence Of Cocl2
 pdb|7ICI|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Soaked In The Presence Of Crcl3
           (0.1 Millimolar)
 pdb|7ICJ|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Soaked In The Presence Of Cucl2
           (0.1 Millimolar)
 pdb|7ICK|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX, SOAKED IN
           The Presence Of Mgcl2
 pdb|7ICL|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Soaked In The Presence Of Mncl2
           (0.1 Millimolar)
 pdb|7ICM|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Soaked In The Presence Of Mncl2
           (1.0 Millimolar)
 pdb|7ICN|A Chain A, Dna Polymerase Beta (e.c.2.7.7.7)/dna Complex, Soaked In
           The Presence Of Nicl2
 pdb|7ICO|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX, SOAKED IN
           The Presence Of Zncl2
 pdb|7ICP|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Soaked In The Presence Of Zncl2
           (0.01 Millimolar)
 pdb|7ICQ|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX, SOAKED IN
           The Presence Of Zncl2
 pdb|7ICR|A Chain A, Dna Polymerase Beta (e.c.2.7.7.7)/dna Complex, Soaked In
           The Presence Of Zncl2
 pdb|7ICS|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX, SOAKED IN
           The Presence Of Zncl2
 pdb|7ICT|A Chain A, Dna Polymerase Beta (E.C.2.7.7.7)DNA COMPLEX, SOAKED IN
           The Presence Of Zncl2 And Mgcl2
 pdb|7ICU|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Soaked In The Presence Of Cdcl2
           (0.1 Millimolar)
 pdb|7ICV|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Six Base Pairs Of Dna; Soaked In The Presence Of Mncl2
           (0.1 Millimolar) And In The Absence Of Nacl
 pdb|8ICA|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Datp
           (1 Millimolar) And Cacl2 (5 Millimolar)
 pdb|1ZQA|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Kcl
           (150 Millimolar) At Ph 7.5
 pdb|1ZQB|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Bacl2
           (150 Millimolar)
 pdb|1ZQC|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Cacl2
           (15 Millimolar)
 pdb|1ZQD|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Cacl2
           (150 Millimolar)
 pdb|1ZQE|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Crcl3
           (saturated Solution)
 pdb|1ZQF|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Cscl
           (150 Millimolar)
 pdb|1ZQG|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of A
           Sodium-Free Artificial Mother Liquor At Ph 6.5
 pdb|1ZQH|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of A
           Sodium-Free Artificial Mother Liquor At Ph 7.5
 pdb|1ZQI|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Kcl
           (150 Millimolar)
 pdb|1ZQJ|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Cacl2
           (15 Millimolar) And Mgcl2 (15 Millimolar)
 pdb|1ZQK|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Kcl
           (75 Millimolar) And Mgcl2 (75 Millimolar)
 pdb|1ZQL|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Mncl2
           (15 Millimolar) And Mgcl2 (15 Millimolar)
 pdb|1ZQM|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Mncl2
           (15 Millimolar)
 pdb|1ZQN|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Bacl2
           (15 Millimolar) And Nacl (15 Millimolar)
 pdb|1ZQO|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Cacl2
           (15 Millimolar) And Nacl (15 Millimolar)
 pdb|1ZQP|A Chain A, Dna Polymerase Beta (Pol B) (E.C.2.7.7.7) Complexed With
           Seven Base Pairs Of Dna; Soaked In The Presence Of Kcl
           (75 Millimolar) And Nacl (75 Millimolar)
 pdb|1BPX|A Chain A, Dna Polymerase BetaDNA COMPLEX
 pdb|1BPY|A Chain A, Human Dna Polymerase Beta Complexed With Gapped Dna And
           Ddctp
 pdb|1BPZ|A Chain A, Human Dna Polymerase Beta Complexed With Nicked Dna
 pdb|1MQ2|A Chain A, Human Dna Polymerase Beta Complexed With Gapped Dna
           Containing An 8-Oxo-7,8-Dihydro-Guanine And Damp
 pdb|1MQ3|A Chain A, Human Dna Polymerase Beta Complexed With Gapped Dna
           Containing An 8-Oxo-7,8-Dihydro-Guanine Template Paired
           With Dctp
 pdb|1TV9|A Chain A, Human Dna Polymerase Beta Complexed With Nicked Dna
           Containing A Mismatched Template Adenine And Incoming
           Cytidine
 pdb|1TVA|A Chain A, Human Dna Polymerase Beta Complexed With Nicked Dna
           Containing A Mismatched Template Thymidine And Incoming
           Cytidine
 pdb|1ZJM|A Chain A, Human Dna Polymerase Beta Complexed With Dna Containing An
           A-A Mismatched Primer Terminus
 pdb|1ZJN|A Chain A, Human Dna Polymerase Beta Complexed With Dna Containing An
           A-A Mismatched Primer Terminus With Dgtp
 pdb|2FMP|A Chain A, Dna Polymerase Beta With A Terminated Gapped Dna Substrate
           And Ddctp With Sodium In The Catalytic Site
 pdb|2FMQ|A Chain A, Sodium In Active Site Of Dna Polymerase Beta
 pdb|2FMS|A Chain A, Dna Polymerase Beta With A Gapped Dna Substrate And
           Dumpnpp With Magnesium In The Catalytic Site
 pdb|2I9G|A Chain A, Dna Polymerase Beta With A Benzo[c]phenanthrene Diol
           Epoxide Adducted Guanine Base
 pdb|2ISO|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Terminated Primer And 2'-Deoxyguanosine 5'-Beta, Gamma-
           Difluoromethylene Triphosphate
 pdb|2ISP|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Terminated Primer And 2'-Deoxyguanosine 5'-Beta, Gamma-
           Methylene Triphosphate
 pdb|2P66|A Chain A, Human Dna Polymerase Beta Complexed With Tetrahydrofuran
           (abasic Site) Containing Dna
 pdb|2PXI|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Terminated Primer And 2'-Deoxyguanosine 5'-Beta, Gamma-
           Monofluoromethylene Triphosphate
 pdb|3C2K|A Chain A, Dna Polymerase Beta With A Gapped Dna Substrate And
           Dumpnpp With Manganese In The Active Site
 pdb|3C2L|A Chain A, Ternary Complex Of Dna Polymerase Beta With A C:dapcpp
           Mismatch In The Active Site
 pdb|3C2M|A Chain A, Ternary Complex Of Dna Polymerase Beta With A G:dapcpp
           Mismatch In The Active Site
 pdb|3ISB|A Chain A, Binary Complex Of Human Dna Polymerase Beta With A Gapped
           Dna
 pdb|3ISC|A Chain A, Binary Complex Of Human Dna Polymerase Beta With An Abasic
           Site (Thf) In The Gapped Dna
 pdb|3ISD|A Chain A, Ternary Complex Of Human Dna Polymerase Beta With An
           Abasic Site (Thf): Dapcpp Mismatch
 pdb|3JPN|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Termin Primer And 2'-Deoxyguanosine 5'-Beta,
           Gamma-Dichloro Methyl Triphosphate
 pdb|3JPO|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Termin Primer And 2'-Deoxyguanosine 5'-Beta,
           Gamma-Monochloromethy Triphosphate
 pdb|3JPP|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Termin Primer And 2'-Deoxyguanosine 5'-Beta,
           Gamma-Monomethyl Meth Triphosphate
 pdb|3JPQ|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Termin Primer And 2'-Deoxyguanosine 5'-Beta,
           Gamma-Monobromo Methy Triphosphate
 pdb|3JPR|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Termin Primer And 2'-Deoxyguanosine 5'-Beta,
           Gamma-Dimethyl Methyl Triphosphate
 pdb|3JPS|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Termin Primer And 2'-Deoxyguanosine 5'-Beta,
           Gamma-Fluoro Methyl M Triphosphate
 pdb|3JPT|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Termin Primer And 2'-Deoxyguanosine 5'-Beta,
           Gamma-Fluoro Chloro M Triphosphate
 pdb|3MBY|A Chain A, Ternary Complex Of Dna Polymerase Beta With Template Base
           A And 8oxodgtp In The Active Site With A Dideoxy
           Terminated Primer
 pdb|3LK9|A Chain A, Dna Polymerase Beta With A Gapped Dna Substrate And
           Dtmp(Cf2)p(Cf2)p
 pdb|3RH4|A Chain A, Dna Polymerase Beta With A Dideoxy-Terminated Primer With
           An Incoming Ribonucleotide (Rctp)
 pdb|3RJE|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Gapped Dna
           Containing 8odg At Template Position
 pdb|3RJF|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Gapped Dna
           Containing (Syn)8odg At Template Position Paired With
           Non-Hydrolyzable Datp Analog (Dapcpp)
 pdb|3RJG|A Chain A, Binary Complex Of Dna Polymerase Beta With A Gapped Dna
           Containing 8odg:da Base-Pair At Primer Terminus
 pdb|3RJH|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Gapped Dna
           Containing (Syn)8odg:da At Primer Terminus And
           Dg:dcmp(Cf2)ppin The Active Site
 pdb|3RJI|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Gapped Dna
           Containing 8odg At Template Position Paired With
           Non-Hydrolyzable Dctp Analog (Dcmp(Cf2)pp)
 pdb|3RJJ|A Chain A, Ternary Complex Crystal Structure Of Dna Polymerase Beta
           With Template 8odg Provides Insight Into Mutagenic
           Lesion Bypass
 pdb|3RJK|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Gapped Dna
           Containing 8odg:dc Base Pair At Primer Terminus And
           Dg:dcmp(Cf2)pp In The Active Site
 pdb|3TFR|A Chain A, Ternary Complex Structure Of Dna Polymerase Beta With A
           Gapped Dna Substrate And A, B Damp(Cf2)pp In The Active
           Site
 pdb|3TFS|A Chain A, Ternary Complex Structure Of Dna Polymerase Beta With A
           Gapped Dna Substrate And A, B Damp(Cfh)pp In The Active
           Site: Stereoselective Binding Of (S) Isomer
 pdb|4DO9|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Terminated Primer And 2'-Deoxyguanosine 5'-Beta,
           Gamma-Monofluoromethylene Triphosphate: Stereoselective
           Binding Of R-Isomer
 pdb|4DOA|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Terminated Primer And 2'-Deoxyguanosine 5'-Beta,
           Gamma-Monofluoromethylene Triphosphate: Non-Interactive
           Binding Of S-Isomer
 pdb|4DOB|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Terminated Primer And 2'-Deoxyguanosine 5'-Beta,
           Gamma-Monochlororomethylene Triphosphate:
           Stereoselective Binding Of R-Isomer
 pdb|4DOC|A Chain A, Ternary Complex Of Dna Polymerase Beta With A Dideoxy
           Terminated Primer And 2'-Deoxyguanosine 5'-Beta,
           Gamma-Monochlororomethylene Triphosphate:binding Of
           S-Isomer
          Length = 335

 Score = 26.9 bits (58), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 30/72 (41%), Gaps = 5/72 (6%)

Query: 19  HLSPLGWQQVGNLRKRVEASGLTQKIDLVITSPLL---RTLQTAVGVF--GGDGESQTDG 73
           H   +G +  G+  KR+    + Q  D+V+          + T  G F  G +     D 
Sbjct: 134 HHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDV 193

Query: 74  IDAHPSLTATAT 85
           +  HPS T+ +T
Sbjct: 194 LLTHPSFTSEST 205


>pdb|3GDX|A Chain A, Dna Polymerase Beta With A Gapped Dnd Substrate And
           Dtmp(Cf2)pp
          Length = 326

 Score = 26.9 bits (58), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 30/72 (41%), Gaps = 5/72 (6%)

Query: 19  HLSPLGWQQVGNLRKRVEASGLTQKIDLVITSPLL---RTLQTAVGVF--GGDGESQTDG 73
           H   +G +  G+  KR+    + Q  D+V+          + T  G F  G +     D 
Sbjct: 125 HHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDV 184

Query: 74  IDAHPSLTATAT 85
           +  HPS T+ +T
Sbjct: 185 LLTHPSFTSEST 196


>pdb|3RH5|A Chain A, Dna Polymerase Beta Mutant (Y271) With A
           Dideoxy-Terminated Primer With An Incoming
           Deoxynucleotide (Dctp)
 pdb|3RH6|A Chain A, Dna Polymerase Beta Mutant (Y271) With A
           Dideoxy-Terminated Primer With An Incoming
           Ribonucleotide (Rctp)
          Length = 335

 Score = 26.9 bits (58), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 30/72 (41%), Gaps = 5/72 (6%)

Query: 19  HLSPLGWQQVGNLRKRVEASGLTQKIDLVITSPLL---RTLQTAVGVF--GGDGESQTDG 73
           H   +G +  G+  KR+    + Q  D+V+          + T  G F  G +     D 
Sbjct: 134 HHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDV 193

Query: 74  IDAHPSLTATAT 85
           +  HPS T+ +T
Sbjct: 194 LLTHPSFTSEST 205


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.133    0.401 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,829,155
Number of Sequences: 62578
Number of extensions: 214888
Number of successful extensions: 512
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 510
Number of HSP's gapped (non-prelim): 12
length of query: 219
length of database: 14,973,337
effective HSP length: 95
effective length of query: 124
effective length of database: 9,028,427
effective search space: 1119524948
effective search space used: 1119524948
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)