BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027836
         (218 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2D68|A Chain A, Structure Of The N-Terminal Domain Of Fop (Fgfr1op)
           Protein
 pdb|2D68|B Chain B, Structure Of The N-Terminal Domain Of Fop (Fgfr1op)
           Protein
          Length = 82

 Score = 34.7 bits (78), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 25/42 (59%)

Query: 61  CNDRAKQLHASPSGRLLTALICEYLDWAQLNHTMKVYLPECN 102
            N+  K+   +  GRL+ +L+ E+L +  L+ T+ V+ PE +
Sbjct: 5   VNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETS 46


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.132    0.380 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,245,021
Number of Sequences: 62578
Number of extensions: 248870
Number of successful extensions: 627
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 626
Number of HSP's gapped (non-prelim): 2
length of query: 218
length of database: 14,973,337
effective HSP length: 95
effective length of query: 123
effective length of database: 9,028,427
effective search space: 1110496521
effective search space used: 1110496521
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)