Query         027862
Match_columns 217
No_of_seqs    143 out of 681
Neff          5.3 
Searched_HMMs 46136
Date          Fri Mar 29 02:35:16 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/027862.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/027862hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02629 powdery mildew resist 100.0 7.8E-72 1.7E-76  516.4  17.8  175   42-216    48-224 (387)
  2 PF14416 PMR5N:  PMR5 N termina 100.0 1.1E-29 2.4E-34  177.0   4.7   54   45-98      2-55  (55)
  3 PF13839 PC-Esterase:  GDSL/SGN  99.9 9.3E-25   2E-29  186.4   9.0  104   99-212     1-115 (263)
  4 cd01842 SGNH_hydrolase_like_5   96.5  0.0027 5.9E-08   54.3   3.4   21  116-136     2-22  (183)
  5 cd01834 SGNH_hydrolase_like_2   80.5    0.86 1.9E-05   36.4   1.3   15  113-127     1-15  (191)
  6 cd01829 SGNH_hydrolase_peri2 S  78.9     1.8   4E-05   35.2   2.8   21  115-135     1-21  (200)
  7 COG2845 Uncharacterized protei  78.7     2.7 5.9E-05   39.4   4.1   30  108-137   111-140 (354)
  8 cd01841 NnaC_like NnaC (CMP-Ne  75.5     1.4 3.1E-05   35.1   1.2   13  114-126     1-13  (174)
  9 PF00185 OTCace:  Aspartate/orn  66.1     4.1 8.8E-05   33.5   1.9   24  112-136     1-24  (158)
 10 cd01825 SGNH_hydrolase_peri1 S  64.5     2.9 6.3E-05   33.5   0.7   17  115-131     1-18  (189)
 11 cd01844 SGNH_hydrolase_like_6   60.3     4.4 9.5E-05   32.8   1.1   13  115-127     1-13  (177)
 12 cd01835 SGNH_hydrolase_like_3   59.7     4.1   9E-05   33.1   0.8   13  114-126     2-14  (193)
 13 cd01838 Isoamyl_acetate_hydrol  59.6     4.2 9.1E-05   32.5   0.9   13  115-127     1-13  (199)
 14 cd01820 PAF_acetylesterase_lik  59.3       8 0.00017   32.4   2.5   16  112-127    31-46  (214)
 15 cd01832 SGNH_hydrolase_like_1   59.0     4.3 9.4E-05   32.5   0.8   11  115-125     1-11  (185)
 16 PF12026 DUF3513:  Domain of un  54.0    0.98 2.1E-05   39.6  -3.9   18  110-127   131-148 (210)
 17 cd01827 sialate_O-acetylestera  53.6       6 0.00013   31.8   0.8   13  115-127     2-14  (188)
 18 cd01833 XynB_like SGNH_hydrola  53.1     5.2 0.00011   31.3   0.4   12  115-126     2-13  (157)
 19 cd01831 Endoglucanase_E_like E  52.7     6.5 0.00014   31.5   0.9   13  115-127     1-13  (169)
 20 cd01822 Lysophospholipase_L1_l  52.6     6.4 0.00014   31.1   0.8   12  115-126     2-13  (177)
 21 PRK10528 multifunctional acyl-  49.6     8.7 0.00019   31.8   1.2   15  113-127    10-24  (191)
 22 PRK14805 ornithine carbamoyltr  48.8      11 0.00024   34.5   1.8   25  110-136   144-168 (302)
 23 PF03808 Glyco_tran_WecB:  Glyc  48.3      31 0.00066   28.5   4.3   43   96-140    24-73  (172)
 24 cd00229 SGNH_hydrolase SGNH_hy  45.2     7.3 0.00016   29.3   0.1   12  116-127     1-12  (187)
 25 cd04501 SGNH_hydrolase_like_4   44.2      10 0.00023   30.3   0.8   12  114-125     1-12  (183)
 26 cd01839 SGNH_arylesterase_like  43.7      11 0.00023   31.1   0.9   12  115-126     1-12  (208)
 27 cd01836 FeeA_FeeB_like SGNH_hy  43.1      11 0.00023   30.5   0.8   14  114-127     3-16  (191)
 28 PF09949 DUF2183:  Uncharacteri  41.8      20 0.00044   27.6   2.1   25  102-126    53-77  (100)
 29 PRK04284 ornithine carbamoyltr  41.3      17 0.00037   33.7   1.9   25  111-136   153-177 (332)
 30 PF00702 Hydrolase:  haloacid d  41.0      20 0.00043   29.0   2.0   20  105-124   185-206 (215)
 31 cd01830 XynE_like SGNH_hydrola  40.6      13 0.00028   30.8   0.9   12  115-126     1-12  (204)
 32 cd01828 sialate_O-acetylestera  40.0      14  0.0003   29.3   0.9   12  116-127     2-13  (169)
 33 PLN02527 aspartate carbamoyltr  34.9      27 0.00058   32.0   2.1   26  111-136   149-174 (306)
 34 cd01821 Rhamnogalacturan_acety  34.6      17 0.00038   29.6   0.8   14  115-128     2-15  (198)
 35 PLN02342 ornithine carbamoyltr  34.6      29 0.00063   32.5   2.3   25  110-136   191-215 (348)
 36 PRK00856 pyrB aspartate carbam  34.5      25 0.00054   32.2   1.8   28  110-137   153-180 (305)
 37 PRK02102 ornithine carbamoyltr  34.2      28 0.00061   32.3   2.1   25  111-136   153-177 (331)
 38 PRK03515 ornithine carbamoyltr  33.5      26 0.00056   32.6   1.8   25  111-136   154-178 (336)
 39 cd04502 SGNH_hydrolase_like_7   33.4      20 0.00043   28.5   0.9   12  116-127     2-13  (171)
 40 PF13472 Lipase_GDSL_2:  GDSL-l  33.3      21 0.00046   27.2   1.0   11  117-127     1-11  (179)
 41 COG0078 ArgF Ornithine carbamo  33.0      30 0.00065   32.2   2.1   21  111-133   151-171 (310)
 42 cd04506 SGNH_hydrolase_YpmR_li  32.9      20 0.00043   29.3   0.8   12  115-126     1-12  (204)
 43 COG0034 PurF Glutamine phospho  32.9      22 0.00047   34.8   1.2   33  106-138   341-374 (470)
 44 TIGR01489 DKMTPPase-SF 2,3-dik  32.9      43 0.00094   26.5   2.8   13  113-125   162-174 (188)
 45 cd01840 SGNH_hydrolase_yrhL_li  32.0      23 0.00049   28.0   1.0   18  116-133     2-19  (150)
 46 PRK01713 ornithine carbamoyltr  31.5      33 0.00071   31.8   2.1   25  111-136   154-178 (334)
 47 PF01861 DUF43:  Protein of unk  30.3      23  0.0005   31.8   0.9   12  111-122    43-54  (243)
 48 PRK08192 aspartate carbamoyltr  28.9      36 0.00078   31.7   1.9   26  111-136   157-182 (338)
 49 TIGR00670 asp_carb_tr aspartat  28.2      38 0.00083   30.9   1.9   27  110-136   147-173 (301)
 50 KOG3482 Small nuclear ribonucl  27.2      54  0.0012   24.5   2.2   21   97-117     2-22  (79)
 51 PRK12562 ornithine carbamoyltr  27.2      43 0.00094   31.1   2.1   25  111-136   154-178 (334)
 52 PRK11891 aspartate carbamoyltr  26.7      46 0.00099   32.2   2.2   26  111-136   239-264 (429)
 53 PRK10113 cell division modulat  25.5      33 0.00071   25.4   0.8   18  109-126    37-56  (80)
 54 PF14647 FAM91_N:  FAM91 N-term  25.5      67  0.0015   29.9   3.0   30   99-138   109-138 (308)
 55 PRK14804 ornithine carbamoyltr  25.3      48   0.001   30.4   2.0   25  110-136   150-174 (311)
 56 PRK00779 ornithine carbamoyltr  24.0      44 0.00096   30.5   1.5   26  109-136   148-173 (304)
 57 CHL00073 chlN photochlorophyll  23.8      57  0.0012   31.8   2.3   28  106-136   307-334 (457)
 58 PF09084 NMT1:  NMT1/THI5 like;  23.5      70  0.0015   26.1   2.5   25  109-133    89-113 (216)
 59 PRK07579 hypothetical protein;  22.9 1.5E+02  0.0033   26.5   4.6   22  114-137     2-23  (245)
 60 TIGR00658 orni_carb_tr ornithi  22.6      52  0.0011   30.0   1.7   24  111-136   146-169 (304)
 61 PF03193 DUF258:  Protein of un  22.5      72  0.0016   26.7   2.4   35  101-137    23-57  (161)
 62 PF00657 Lipase_GDSL:  GDSL-lik  21.9      48   0.001   26.7   1.2   11  116-126     1-11  (234)
 63 cd01823 SEST_like SEST_like. A  21.6      48   0.001   28.2   1.2   13  114-126     1-13  (259)
 64 PF13242 Hydrolase_like:  HAD-h  21.4      76  0.0016   22.1   2.0   19  112-130    20-38  (75)
 65 PRK02255 putrescine carbamoylt  20.3      78  0.0017   29.4   2.4   24  111-136   152-175 (338)

No 1  
>PLN02629 powdery mildew resistance 5
Probab=100.00  E-value=7.8e-72  Score=516.44  Aligned_cols=175  Identities=54%  Similarity=1.078  Sum_probs=163.5

Q ss_pred             CCCCCCcCcccceeeCCCCCCCCCCCCC-CccCccccccCCCCCCcccceeeecCCCCCCCCChHHHHHHhcCCcEEEec
Q 027862           42 KQVSGCNLFQGRWVIDPSYPLYDSSSCP-FIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGKRIMFVG  120 (217)
Q Consensus        42 ~~~~~Cd~~~G~WV~d~~~PlY~~~~Cp-~i~~~~~C~~nGRpd~~yl~WrWqP~~C~l~rfd~~~fL~~lrgKrl~FVG  120 (217)
                      ...++||+|+|+||+|+++|+|++++|| ||++++||++|||||++|++|||||++|+||||||.+|||+||||||||||
T Consensus        48 ~~~~~CD~f~G~WV~D~s~PlY~~~~Cp~fi~~~~nC~knGRPD~~Yl~WRWqP~gC~LPRFda~~fLe~~RgKrl~FVG  127 (387)
T PLN02629         48 ANQSTCALFVGTWVRDDSYPLYQSSDCPGVIDPEFNCQMYGRPDSDYLKYRWQPLNCELPRFNGLEFLLKMKGKTVMFVG  127 (387)
T ss_pred             CCccccCCCCCeEecCCCCCCCCCCCCccccccccchhhcCCCCcchhhccccCCCCCCCCcCHHHHHHHhcCCeEEEec
Confidence            5567899999999999999999999999 999999999999999999999999999999999999999999999999999


Q ss_pred             chhhHHHHHHHHHhhcccCCCCeeeeeecCcceEEEEeecceEEEEEEccccccceeccccceEEeccccc-CCCCCCCc
Q 027862          121 DSLSLNMWESLSCMIHASVPNAKTSFVRKETLSSVSFEEYGVTLLLYRTPYLVDIVKQKVGRVLTLNSIQA-GKFWKDMD  199 (217)
Q Consensus       121 DSl~Rnq~~SLlClL~~~~p~~~~~~~~~~~~~~~~f~~yn~Tv~f~WsPfLV~~~~~~~~~~L~lD~~~~-~~~w~~~D  199 (217)
                      |||+|||||||+|||++++|..++...++++..+|+|++||+||+||||||||+.++....++|+||+++. +++|+++|
T Consensus       128 DSL~RNQ~eSLvClL~~~~p~~~~~~~~~~~~~~~~F~~yN~TV~~ywspfLV~~~~~~~~~~l~LD~id~~a~~w~~~D  207 (387)
T PLN02629        128 DSLGRNQWESLICLISSSVPSTRTQMSRGDPLSTFKFLDYGVSISFYKAPYLVDIDAVQGKRVLKLEEISGNANAWRDAD  207 (387)
T ss_pred             cccchhHHHHHHHHhhccCCCCceeeecCCceEEEEeccCCEEEEEEecceEEeeecCCCceeEEecCcchhhhhhccCC
Confidence            99999999999999999998766555567788999999999999999999999988766667999999987 89999999


Q ss_pred             EEEEcccccccCCCCCC
Q 027862          200 VLIFNSWHWWTHTGKAQ  216 (217)
Q Consensus       200 vLV~ntGhWw~~~~~~~  216 (217)
                      ||||||||||.|++..+
T Consensus       208 vlVfntghWw~~~~~~~  224 (387)
T PLN02629        208 VLIFNTGHWWSHQGSLQ  224 (387)
T ss_pred             EEEEeCccccCCCCeeE
Confidence            99999999999987653


No 2  
>PF14416 PMR5N:  PMR5 N terminal Domain
Probab=99.96  E-value=1.1e-29  Score=177.04  Aligned_cols=54  Identities=61%  Similarity=1.400  Sum_probs=52.7

Q ss_pred             CCCcCcccceeeCCCCCCCCCCCCCCccCccccccCCCCCCcccceeeecCCCC
Q 027862           45 SGCNLFQGRWVIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCA   98 (217)
Q Consensus        45 ~~Cd~~~G~WV~d~~~PlY~~~~Cp~i~~~~~C~~nGRpd~~yl~WrWqP~~C~   98 (217)
                      ++||+|+|+||+|+++|||++++||||+++|||++|||||++|++|||||++|+
T Consensus         2 ~~Cd~~~G~WV~D~~~PlY~~~~Cp~i~~~~nC~~nGRpD~~y~~wRWqP~~Cd   55 (55)
T PF14416_consen    2 KRCDYFDGRWVPDPSYPLYTNSTCPFIDEGFNCQKNGRPDSDYLKWRWQPRGCD   55 (55)
T ss_pred             CccCcccCEEEeCCCCCccCCCCCCcCCCccchhhcCCCCCccceeeecCCCCC
Confidence            579999999999999999999999999999999999999999999999999996


No 3  
>PF13839 PC-Esterase:  GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p
Probab=99.91  E-value=9.3e-25  Score=186.43  Aligned_cols=104  Identities=38%  Similarity=0.684  Sum_probs=85.1

Q ss_pred             CCCCChHHHHHHhcCCcEEEecchhhHHHHHHHHHhhcccCC-----CCeeeeeecCcceEEEEeecceEEEEEEccccc
Q 027862           99 VPRFDGGDFLRRYRGKRIMFVGDSLSLNMWESLSCMIHASVP-----NAKTSFVRKETLSSVSFEEYGVTLLLYRTPYLV  173 (217)
Q Consensus        99 l~rfd~~~fL~~lrgKrl~FVGDSl~Rnq~~SLlClL~~~~p-----~~~~~~~~~~~~~~~~f~~yn~Tv~f~WsPfLV  173 (217)
                      |++||+.++|++||||+|+|||||++||||+||+|+|.+..+     +........+....+.|+++|+||+|+|+|||+
T Consensus         1 ~~~~d~~~cL~~lr~k~i~fiGDS~~Rq~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~p~l~   80 (263)
T PF13839_consen    1 LPRFDARECLQRLRNKRIVFIGDSTTRQQYESLVCLLGPEVPSWQESPHSGIEFPNHRNFRYNFPDYNVTLSFYWDPFLV   80 (263)
T ss_pred             CChhhHHHHHHHccCCEEEEEechhhHHHHHHHHHHHhccccccccccccccccccCCceEEeecCCCeEEEEecccccc
Confidence            689999999999999999999999999999999999998776     222222233566788899999999999999999


Q ss_pred             cceeccccceEEecccc-c-CCCCC----CCcEEEEcccccccCC
Q 027862          174 DIVKQKVGRVLTLNSIQ-A-GKFWK----DMDVLIFNSWHWWTHT  212 (217)
Q Consensus       174 ~~~~~~~~~~L~lD~~~-~-~~~w~----~~DvLV~ntGhWw~~~  212 (217)
                      +.          +|.++ . ...|.    .+||||+|+|+||.+.
T Consensus        81 ~~----------l~~~~~~~~~~~~~~~~~pdvvV~nsG~W~~~~  115 (263)
T PF13839_consen   81 DQ----------LDSIDEEIANNWPTSGARPDVVVINSGLWYLRR  115 (263)
T ss_pred             cc----------ccccchhhhccccccccCCCEEEEEcchhhhhc
Confidence            64          33333 1 34444    8999999999999975


No 4  
>cd01842 SGNH_hydrolase_like_5 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=96.45  E-value=0.0027  Score=54.35  Aligned_cols=21  Identities=19%  Similarity=0.591  Sum_probs=20.2

Q ss_pred             EEEecchhhHHHHHHHHHhhc
Q 027862          116 IMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       116 l~FVGDSl~Rnq~~SLlClL~  136 (217)
                      ++|+|||+.|-+|--|+|+|+
T Consensus         2 v~~lgds~~ravykdlv~l~q   22 (183)
T cd01842           2 VVILGDSIQRAVYKDLVLLLQ   22 (183)
T ss_pred             EEEEccHHHHHHHHHHHHHhc
Confidence            789999999999999999997


No 5  
>cd01834 SGNH_hydrolase_like_2 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=80.52  E-value=0.86  Score=36.37  Aligned_cols=15  Identities=40%  Similarity=0.791  Sum_probs=13.9

Q ss_pred             CCcEEEecchhhHHH
Q 027862          113 GKRIMFVGDSLSLNM  127 (217)
Q Consensus       113 gKrl~FVGDSl~Rnq  127 (217)
                      |+||+|+|||++...
T Consensus         1 ~~~v~~~GDSit~g~   15 (191)
T cd01834           1 GDRIVFIGNSITDRG   15 (191)
T ss_pred             CCEEEEeCCChhhcc
Confidence            799999999999976


No 6  
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=78.85  E-value=1.8  Score=35.21  Aligned_cols=21  Identities=29%  Similarity=0.510  Sum_probs=17.2

Q ss_pred             cEEEecchhhHHHHHHHHHhh
Q 027862          115 RIMFVGDSLSLNMWESLSCMI  135 (217)
Q Consensus       115 rl~FVGDSl~Rnq~~SLlClL  135 (217)
                      ||+|+|||++....-++...+
T Consensus         1 ril~iGDS~~~g~~~~l~~~~   21 (200)
T cd01829           1 RVLVIGDSLAQGLAPGLLRAL   21 (200)
T ss_pred             CEEEEechHHHHHHHHHHHHh
Confidence            689999999999877766444


No 7  
>COG2845 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=78.71  E-value=2.7  Score=39.35  Aligned_cols=30  Identities=23%  Similarity=0.379  Sum_probs=24.6

Q ss_pred             HHHhcCCcEEEecchhhHHHHHHHHHhhcc
Q 027862          108 LRRYRGKRIMFVGDSLSLNMWESLSCMIHA  137 (217)
Q Consensus       108 L~~lrgKrl~FVGDSl~Rnq~~SLlClL~~  137 (217)
                      .+.=.+++|.|||||+++..-+.|...|..
T Consensus       111 ~k~~~a~kvLvvGDslm~gla~gl~~al~t  140 (354)
T COG2845         111 AKSRDADKVLVVGDSLMQGLAEGLDKALAT  140 (354)
T ss_pred             hhCCCCCEEEEechHHhhhhHHHHHHHhcc
Confidence            344467899999999999999998888754


No 8  
>cd01841 NnaC_like NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.
Probab=75.47  E-value=1.4  Score=35.14  Aligned_cols=13  Identities=54%  Similarity=0.807  Sum_probs=11.7

Q ss_pred             CcEEEecchhhHH
Q 027862          114 KRIMFVGDSLSLN  126 (217)
Q Consensus       114 Krl~FVGDSl~Rn  126 (217)
                      |+|+|+|||++..
T Consensus         1 ~~iv~~GdS~t~~   13 (174)
T cd01841           1 KNIVFIGDSLFEG   13 (174)
T ss_pred             CCEEEEcchhhhc
Confidence            7899999999975


No 9  
>PF00185 OTCace:  Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain;  InterPro: IPR006131 This family contains two related enzymes:  Aspartate carbamoyltransferase (2.1.3.2 from EC) (ATCase) catalyzes the conversion of aspartate and carbamoyl phosphate to carbamoylaspartate, the second step in the de novo biosynthesis of pyrimidine nucleotides []. In prokaryotes ATCase consists of two subunits: a catalytic chain (gene pyrB) and a regulatory chain (gene pyrI), while in eukaryotes it is a domain in a multi- functional enzyme (called URA2 in yeast, rudimentary in Drosophila, and CAD in mammals []) that also catalyzes other steps of the biosynthesis of pyrimidines. Ornithine carbamoyltransferase (2.1.3.3 from EC) (OTCase) catalyzes the conversion of ornithine and carbamoyl phosphate to citrulline. In mammals this enzyme participates in the urea cycle [] and is located in the mitochondrial matrix. In prokaryotes and eukaryotic microorganisms it is involved in the biosynthesis of arginine. In some bacterial species it is also involved in the degradation of arginine [] (the arginine deaminase pathway).  It has been shown [] that these two enzymes are evolutionary related. The predicted secondary structure of both enzymes are similar and there are some regions of sequence similarities. One of these regions includes three residues which have been shown, by crystallographic studies [], to be implicated in binding the phosphoryl group of carbamoyl phosphate and is described by IPR006132 from INTERPRO. The carboxyl-terminal, aspartate/ornithine-binding domain is connected to the amino-terminal domain by two alpha-helices, which comprise a hinge between domains [].; GO: 0016597 amino acid binding, 0016743 carboxyl- or carbamoyltransferase activity, 0006520 cellular amino acid metabolic process; PDB: 1ML4_A 4EP1_B 3Q98_A 3E2P_A 2RGW_E 4EKN_B 2G7M_E 3D6N_B 3M4J_A 3L06_A ....
Probab=66.13  E-value=4.1  Score=33.48  Aligned_cols=24  Identities=29%  Similarity=0.422  Sum_probs=20.6

Q ss_pred             cCCcEEEecchhhHHHHHHHHHhhc
Q 027862          112 RGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       112 rgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      .|++|+|||| ..-|...|++.++.
T Consensus         1 ~gl~i~~vGD-~~~rv~~Sl~~~~~   24 (158)
T PF00185_consen    1 KGLKIAYVGD-GHNRVAHSLIELLA   24 (158)
T ss_dssp             TTEEEEEESS-TTSHHHHHHHHHHH
T ss_pred             CCCEEEEECC-CCChHHHHHHHHHH
Confidence            4899999999 65678999998885


No 10 
>cd01825 SGNH_hydrolase_peri1 SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=64.52  E-value=2.9  Score=33.47  Aligned_cols=17  Identities=29%  Similarity=0.464  Sum_probs=12.4

Q ss_pred             cEEEecchhhHH-HHHHH
Q 027862          115 RIMFVGDSLSLN-MWESL  131 (217)
Q Consensus       115 rl~FVGDSl~Rn-q~~SL  131 (217)
                      ||+|+|||++-. .|-+.
T Consensus         1 ~iv~~GDS~t~g~~~~~~   18 (189)
T cd01825           1 RIAQLGDSHIAGDFFTDV   18 (189)
T ss_pred             CeeEecCccccccchhhH
Confidence            799999999963 34443


No 11 
>cd01844 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=60.28  E-value=4.4  Score=32.76  Aligned_cols=13  Identities=31%  Similarity=0.429  Sum_probs=11.3

Q ss_pred             cEEEecchhhHHH
Q 027862          115 RIMFVGDSLSLNM  127 (217)
Q Consensus       115 rl~FVGDSl~Rnq  127 (217)
                      ||+|+|||++...
T Consensus         1 ~iv~~GDSit~G~   13 (177)
T cd01844           1 PWVFYGTSISQGA   13 (177)
T ss_pred             CEEEEeCchhcCc
Confidence            6899999999864


No 12 
>cd01835 SGNH_hydrolase_like_3 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=59.72  E-value=4.1  Score=33.08  Aligned_cols=13  Identities=54%  Similarity=0.861  Sum_probs=11.6

Q ss_pred             CcEEEecchhhHH
Q 027862          114 KRIMFVGDSLSLN  126 (217)
Q Consensus       114 Krl~FVGDSl~Rn  126 (217)
                      +||+|+|||++..
T Consensus         2 ~~i~~lGDSit~G   14 (193)
T cd01835           2 KRLIVVGDSLVYG   14 (193)
T ss_pred             cEEEEEcCccccC
Confidence            6899999999975


No 13 
>cd01838 Isoamyl_acetate_hydrolase_like Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash.  The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases
Probab=59.62  E-value=4.2  Score=32.55  Aligned_cols=13  Identities=31%  Similarity=0.567  Sum_probs=11.3

Q ss_pred             cEEEecchhhHHH
Q 027862          115 RIMFVGDSLSLNM  127 (217)
Q Consensus       115 rl~FVGDSl~Rnq  127 (217)
                      ||+|+|||++...
T Consensus         1 ~i~~~GDSit~g~   13 (199)
T cd01838           1 KIVLFGDSITQFS   13 (199)
T ss_pred             CEEEecCcccccc
Confidence            6899999999863


No 14 
>cd01820 PAF_acetylesterase_like PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases. Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues.  In addition,  PAF and PAF-AH are associated with neural migration and mammalian reproduction.
Probab=59.32  E-value=8  Score=32.35  Aligned_cols=16  Identities=31%  Similarity=0.725  Sum_probs=13.0

Q ss_pred             cCCcEEEecchhhHHH
Q 027862          112 RGKRIMFVGDSLSLNM  127 (217)
Q Consensus       112 rgKrl~FVGDSl~Rnq  127 (217)
                      ...+|+|+|||++...
T Consensus        31 ~~~~iv~lGDSit~g~   46 (214)
T cd01820          31 KEPDVVFIGDSITQNW   46 (214)
T ss_pred             CCCCEEEECchHhhhh
Confidence            3457999999999964


No 15 
>cd01832 SGNH_hydrolase_like_1 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
Probab=58.98  E-value=4.3  Score=32.50  Aligned_cols=11  Identities=36%  Similarity=0.609  Sum_probs=10.0

Q ss_pred             cEEEecchhhH
Q 027862          115 RIMFVGDSLSL  125 (217)
Q Consensus       115 rl~FVGDSl~R  125 (217)
                      ||+|+|||++.
T Consensus         1 ~i~~~GDSit~   11 (185)
T cd01832           1 RYVALGDSITE   11 (185)
T ss_pred             CeeEecchhhc
Confidence            69999999996


No 16 
>PF12026 DUF3513:  Domain of unknown function (DUF3513);  InterPro: IPR021901  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 192 to 218 amino acids in length. This domain is found associated with PF00018 from PFAM, PF08824 from PFAM. This domain has a conserved QPP sequence motif. ; PDB: 3T6G_D 1X27_N.
Probab=54.01  E-value=0.98  Score=39.61  Aligned_cols=18  Identities=22%  Similarity=0.567  Sum_probs=14.9

Q ss_pred             HhcCCcEEEecchhhHHH
Q 027862          110 RYRGKRIMFVGDSLSLNM  127 (217)
Q Consensus       110 ~lrgKrl~FVGDSl~Rnq  127 (217)
                      +|-|.+++||||+|.|+.
T Consensus       131 Il~ahkLVfiGDTl~r~~  148 (210)
T PF12026_consen  131 ILSAHKLVFIGDTLCREA  148 (210)
T ss_dssp             HHHHHHHHHHHHHHHHC-
T ss_pred             EEEeeeeeeeccHHHHHh
Confidence            377889999999999864


No 17 
>cd01827 sialate_O-acetylesterase_like1 sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=53.57  E-value=6  Score=31.82  Aligned_cols=13  Identities=23%  Similarity=0.511  Sum_probs=10.7

Q ss_pred             cEEEecchhhHHH
Q 027862          115 RIMFVGDSLSLNM  127 (217)
Q Consensus       115 rl~FVGDSl~Rnq  127 (217)
                      ||+|+|||++...
T Consensus         2 ~i~~~GDSit~G~   14 (188)
T cd01827           2 KVACVGNSITEGA   14 (188)
T ss_pred             eEEEEeccccccc
Confidence            7999999996643


No 18 
>cd01833 XynB_like SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=53.11  E-value=5.2  Score=31.31  Aligned_cols=12  Identities=50%  Similarity=0.792  Sum_probs=10.3

Q ss_pred             cEEEecchhhHH
Q 027862          115 RIMFVGDSLSLN  126 (217)
Q Consensus       115 rl~FVGDSl~Rn  126 (217)
                      ||++||||++-.
T Consensus         2 ~~~~~Gds~~~g   13 (157)
T cd01833           2 RIMPLGDSITWG   13 (157)
T ss_pred             ceeecCCceeec
Confidence            689999999865


No 19 
>cd01831 Endoglucanase_E_like Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
Probab=52.68  E-value=6.5  Score=31.49  Aligned_cols=13  Identities=38%  Similarity=0.802  Sum_probs=11.0

Q ss_pred             cEEEecchhhHHH
Q 027862          115 RIMFVGDSLSLNM  127 (217)
Q Consensus       115 rl~FVGDSl~Rnq  127 (217)
                      +|+|+|||++-..
T Consensus         1 ~i~~iGDSit~G~   13 (169)
T cd01831           1 KIEFIGDSITCGY   13 (169)
T ss_pred             CEEEEeccccccC
Confidence            5899999998863


No 20 
>cd01822 Lysophospholipase_L1_like Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.
Probab=52.56  E-value=6.4  Score=31.11  Aligned_cols=12  Identities=42%  Similarity=0.675  Sum_probs=10.3

Q ss_pred             cEEEecchhhHH
Q 027862          115 RIMFVGDSLSLN  126 (217)
Q Consensus       115 rl~FVGDSl~Rn  126 (217)
                      ||+|+|||++..
T Consensus         2 ~i~~~GDSit~G   13 (177)
T cd01822           2 TILALGDSLTAG   13 (177)
T ss_pred             eEEEEccccccC
Confidence            799999999754


No 21 
>PRK10528 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1; Provisional
Probab=49.60  E-value=8.7  Score=31.79  Aligned_cols=15  Identities=33%  Similarity=0.620  Sum_probs=12.8

Q ss_pred             CCcEEEecchhhHHH
Q 027862          113 GKRIMFVGDSLSLNM  127 (217)
Q Consensus       113 gKrl~FVGDSl~Rnq  127 (217)
                      +.+|+|+|||++...
T Consensus        10 ~~~iv~~GDSit~G~   24 (191)
T PRK10528         10 ADTLLILGDSLSAGY   24 (191)
T ss_pred             CCEEEEEeCchhhcC
Confidence            679999999999763


No 22 
>PRK14805 ornithine carbamoyltransferase; Provisional
Probab=48.80  E-value=11  Score=34.47  Aligned_cols=25  Identities=24%  Similarity=0.256  Sum_probs=20.8

Q ss_pred             HhcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          110 RYRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       110 ~lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      .++|++|+||||.  .|...|++.++.
T Consensus       144 ~l~g~kva~vGD~--~~v~~S~~~~~~  168 (302)
T PRK14805        144 DVSKVKLAYVGDG--NNVTHSLMYGAA  168 (302)
T ss_pred             CcCCcEEEEEcCC--CccHHHHHHHHH
Confidence            3789999999994  568899998875


No 23 
>PF03808 Glyco_tran_WecB:  Glycosyl transferase WecB/TagA/CpsF family;  InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway.; GO: 0009058 biosynthetic process
Probab=48.28  E-value=31  Score=28.52  Aligned_cols=43  Identities=28%  Similarity=0.517  Sum_probs=28.5

Q ss_pred             CCCC-CCCChHHHHHHh------cCCcEEEecchhhHHHHHHHHHhhcccCC
Q 027862           96 SCAV-PRFDGGDFLRRY------RGKRIMFVGDSLSLNMWESLSCMIHASVP  140 (217)
Q Consensus        96 ~C~l-~rfd~~~fL~~l------rgKrl~FVGDSl~Rnq~~SLlClL~~~~p  140 (217)
                      |-.+ +|+++.+|+..+      +|++|.|+|.+-  ..-+.+...|.+..|
T Consensus        24 g~~~~~rv~g~dl~~~l~~~~~~~~~~ifllG~~~--~~~~~~~~~l~~~yP   73 (172)
T PF03808_consen   24 GRPLPERVTGSDLFPDLLRRAEQRGKRIFLLGGSE--EVLEKAAANLRRRYP   73 (172)
T ss_pred             CCCCCcccCHHHHHHHHHHHHHHcCCeEEEEeCCH--HHHHHHHHHHHHHCC
Confidence            5666 788998877553      568999999884  333444555544443


No 24 
>cd00229 SGNH_hydrolase SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=45.23  E-value=7.3  Score=29.28  Aligned_cols=12  Identities=33%  Similarity=0.744  Sum_probs=10.4

Q ss_pred             EEEecchhhHHH
Q 027862          116 IMFVGDSLSLNM  127 (217)
Q Consensus       116 l~FVGDSl~Rnq  127 (217)
                      |+|+|||++...
T Consensus         1 i~~~GDS~~~g~   12 (187)
T cd00229           1 ILVIGDSITAGY   12 (187)
T ss_pred             Ceeecccccccc
Confidence            689999999874


No 25 
>cd04501 SGNH_hydrolase_like_4 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=44.22  E-value=10  Score=30.34  Aligned_cols=12  Identities=33%  Similarity=0.744  Sum_probs=10.4

Q ss_pred             CcEEEecchhhH
Q 027862          114 KRIMFVGDSLSL  125 (217)
Q Consensus       114 Krl~FVGDSl~R  125 (217)
                      .||+|+|||++.
T Consensus         1 ~~i~~~GDSi~~   12 (183)
T cd04501           1 MRVVCLGDSITY   12 (183)
T ss_pred             CeEEEEcccccc
Confidence            379999999996


No 26 
>cd01839 SGNH_arylesterase_like SGNH_hydrolase subfamily, similar to arylesterase (7-aminocephalosporanic acid-deacetylating enzyme) of A. tumefaciens. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=43.74  E-value=11  Score=31.14  Aligned_cols=12  Identities=33%  Similarity=0.490  Sum_probs=10.3

Q ss_pred             cEEEecchhhHH
Q 027862          115 RIMFVGDSLSLN  126 (217)
Q Consensus       115 rl~FVGDSl~Rn  126 (217)
                      +|+|+|||++..
T Consensus         1 ~I~~~GDSiT~G   12 (208)
T cd01839           1 TILCFGDSNTWG   12 (208)
T ss_pred             CEEEEecCcccC
Confidence            689999999864


No 27 
>cd01836 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=43.10  E-value=11  Score=30.46  Aligned_cols=14  Identities=29%  Similarity=0.577  Sum_probs=11.7

Q ss_pred             CcEEEecchhhHHH
Q 027862          114 KRIMFVGDSLSLNM  127 (217)
Q Consensus       114 Krl~FVGDSl~Rnq  127 (217)
                      .|++|+|||++-..
T Consensus         3 ~~i~~~GDSit~G~   16 (191)
T cd01836           3 LRLLVLGDSTAAGV   16 (191)
T ss_pred             eEEEEEeccccccc
Confidence            37999999999763


No 28 
>PF09949 DUF2183:  Uncharacterized conserved protein (DUF2183);  InterPro: IPR019236  This domain, found in various bacterial and fungal proteins, has no known function. 
Probab=41.78  E-value=20  Score=27.63  Aligned_cols=25  Identities=20%  Similarity=0.381  Sum_probs=20.1

Q ss_pred             CChHHHHHHhcCCcEEEecchhhHH
Q 027862          102 FDGGDFLRRYRGKRIMFVGDSLSLN  126 (217)
Q Consensus       102 fd~~~fL~~lrgKrl~FVGDSl~Rn  126 (217)
                      -.-+++++..-+++.++||||-..-
T Consensus        53 ~~i~~i~~~fP~~kfiLIGDsgq~D   77 (100)
T PF09949_consen   53 DNIERILRDFPERKFILIGDSGQHD   77 (100)
T ss_pred             HHHHHHHHHCCCCcEEEEeeCCCcC
Confidence            3445788889999999999997654


No 29 
>PRK04284 ornithine carbamoyltransferase; Provisional
Probab=41.27  E-value=17  Score=33.69  Aligned_cols=25  Identities=24%  Similarity=0.393  Sum_probs=20.8

Q ss_pred             hcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          111 YRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       111 lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      ++|++|+||||..+ |...|++-++.
T Consensus       153 l~g~kia~vGD~~~-~v~~Sl~~~~~  177 (332)
T PRK04284        153 YKDIKFTYVGDGRN-NVANALMQGAA  177 (332)
T ss_pred             cCCcEEEEecCCCc-chHHHHHHHHH
Confidence            67999999999766 58888888775


No 30 
>PF00702 Hydrolase:  haloacid dehalogenase-like hydrolase;  InterPro: IPR005834  This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase). This group includes L-2-haloacid dehalogenase, epoxide hydrolases and phosphatases. The structure consists of two domains. One is an inserted four helix bundle, which is the least well conserved region of the alignment, between residues 16 and 96 of HAD1_PSESP. The rest of the fold is composed of the core alpha/beta domain.; GO: 0003824 catalytic activity, 0008152 metabolic process; PDB: 1TE2_A 3NAL_A 3NAM_A 3NAN_A 3A1D_B 3J09_A 3J08_A 2B8E_C 3A1E_A 2VOY_J ....
Probab=41.04  E-value=20  Score=28.98  Aligned_cols=20  Identities=15%  Similarity=0.388  Sum_probs=15.8

Q ss_pred             HHHHHHhc--CCcEEEecchhh
Q 027862          105 GDFLRRYR--GKRIMFVGDSLS  124 (217)
Q Consensus       105 ~~fL~~lr--gKrl~FVGDSl~  124 (217)
                      .++++.|+  +.++++|||+++
T Consensus       185 ~~~i~~l~~~~~~v~~vGDg~n  206 (215)
T PF00702_consen  185 LRIIKELQVKPGEVAMVGDGVN  206 (215)
T ss_dssp             HHHHHHHTCTGGGEEEEESSGG
T ss_pred             HHHHHHHhcCCCEEEEEccCHH
Confidence            46677776  568999999994


No 31 
>cd01830 XynE_like SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=40.59  E-value=13  Score=30.75  Aligned_cols=12  Identities=25%  Similarity=0.506  Sum_probs=10.2

Q ss_pred             cEEEecchhhHH
Q 027862          115 RIMFVGDSLSLN  126 (217)
Q Consensus       115 rl~FVGDSl~Rn  126 (217)
                      .|+|+|||++..
T Consensus         1 ~iv~~GDSiT~G   12 (204)
T cd01830           1 SVVALGDSITDG   12 (204)
T ss_pred             CEEEEecccccC
Confidence            489999999964


No 32 
>cd01828 sialate_O-acetylesterase_like2 sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=39.96  E-value=14  Score=29.31  Aligned_cols=12  Identities=42%  Similarity=0.731  Sum_probs=10.5

Q ss_pred             EEEecchhhHHH
Q 027862          116 IMFVGDSLSLNM  127 (217)
Q Consensus       116 l~FVGDSl~Rnq  127 (217)
                      |+|+|||+.+..
T Consensus         2 v~~~GdSi~~~~   13 (169)
T cd01828           2 LVFLGDSLTEGG   13 (169)
T ss_pred             EEEecchhhccC
Confidence            789999999864


No 33 
>PLN02527 aspartate carbamoyltransferase
Probab=34.94  E-value=27  Score=31.97  Aligned_cols=26  Identities=23%  Similarity=0.328  Sum_probs=20.8

Q ss_pred             hcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          111 YRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       111 lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      ++|++|+||||-.+-|...|++-.|.
T Consensus       149 l~g~kva~vGD~~~~rv~~Sl~~~~~  174 (306)
T PLN02527        149 LDGIKVGLVGDLANGRTVRSLAYLLA  174 (306)
T ss_pred             cCCCEEEEECCCCCChhHHHHHHHHH
Confidence            78999999999865467888877764


No 34 
>cd01821 Rhamnogalacturan_acetylesterase_like Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
Probab=34.63  E-value=17  Score=29.62  Aligned_cols=14  Identities=29%  Similarity=0.342  Sum_probs=11.7

Q ss_pred             cEEEecchhhHHHH
Q 027862          115 RIMFVGDSLSLNMW  128 (217)
Q Consensus       115 rl~FVGDSl~Rnq~  128 (217)
                      +|+|+|||++....
T Consensus         2 ~i~~~GDS~t~G~~   15 (198)
T cd01821           2 TIFLAGDSTVADYD   15 (198)
T ss_pred             EEEEEecCCcccCC
Confidence            68999999998653


No 35 
>PLN02342 ornithine carbamoyltransferase
Probab=34.58  E-value=29  Score=32.52  Aligned_cols=25  Identities=28%  Similarity=0.529  Sum_probs=20.9

Q ss_pred             HhcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          110 RYRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       110 ~lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      .+.|++|+||||-  .|...||+.++.
T Consensus       191 ~l~glkva~vGD~--~nva~Sli~~~~  215 (348)
T PLN02342        191 RLEGTKVVYVGDG--NNIVHSWLLLAA  215 (348)
T ss_pred             CcCCCEEEEECCC--chhHHHHHHHHH
Confidence            3789999999995  369999998875


No 36 
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional
Probab=34.47  E-value=25  Score=32.20  Aligned_cols=28  Identities=21%  Similarity=0.229  Sum_probs=21.9

Q ss_pred             HhcCCcEEEecchhhHHHHHHHHHhhcc
Q 027862          110 RYRGKRIMFVGDSLSLNMWESLSCMIHA  137 (217)
Q Consensus       110 ~lrgKrl~FVGDSl~Rnq~~SLlClL~~  137 (217)
                      .++|++|+||||-..-|...|++-++..
T Consensus       153 ~l~g~kv~~vGD~~~~~v~~Sl~~~~~~  180 (305)
T PRK00856        153 RLEGLKVAIVGDIKHSRVARSNIQALTR  180 (305)
T ss_pred             CCCCCEEEEECCCCCCcHHHHHHHHHHH
Confidence            3789999999997655778888877643


No 37 
>PRK02102 ornithine carbamoyltransferase; Validated
Probab=34.19  E-value=28  Score=32.35  Aligned_cols=25  Identities=32%  Similarity=0.432  Sum_probs=20.8

Q ss_pred             hcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          111 YRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       111 lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      ++|++|+||||.-+ |...|++.++.
T Consensus       153 l~g~~va~vGd~~~-~v~~Sl~~~~~  177 (331)
T PRK02102        153 LKGLKLAYVGDGRN-NMANSLMVGGA  177 (331)
T ss_pred             CCCCEEEEECCCcc-cHHHHHHHHHH
Confidence            68999999999865 48889888774


No 38 
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional
Probab=33.53  E-value=26  Score=32.60  Aligned_cols=25  Identities=24%  Similarity=0.337  Sum_probs=19.9

Q ss_pred             hcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          111 YRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       111 lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      +.|++|+||||-.+ |...|++-++.
T Consensus       154 l~g~~ia~vGD~~~-~v~~Sl~~~~~  178 (336)
T PRK03515        154 FNEMTLAYAGDARN-NMGNSLLEAAA  178 (336)
T ss_pred             cCCCEEEEeCCCcC-cHHHHHHHHHH
Confidence            56899999999434 58888888774


No 39 
>cd04502 SGNH_hydrolase_like_7 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=33.35  E-value=20  Score=28.48  Aligned_cols=12  Identities=33%  Similarity=0.332  Sum_probs=10.3

Q ss_pred             EEEecchhhHHH
Q 027862          116 IMFVGDSLSLNM  127 (217)
Q Consensus       116 l~FVGDSl~Rnq  127 (217)
                      |+|||||+.+.-
T Consensus         2 i~~~g~s~~~~w   13 (171)
T cd04502           2 ILFYGSSSIRLW   13 (171)
T ss_pred             EEEEcCchhcch
Confidence            799999999864


No 40 
>PF13472 Lipase_GDSL_2:  GDSL-like Lipase/Acylhydrolase family; PDB: 1ES9_A 1WAB_A 3DT9_A 1BWQ_A 1FXW_A 3DT6_A 1BWR_A 3DT8_A 1BWP_A 2WAA_A ....
Probab=33.27  E-value=21  Score=27.19  Aligned_cols=11  Identities=36%  Similarity=0.824  Sum_probs=9.2

Q ss_pred             EEecchhhHHH
Q 027862          117 MFVGDSLSLNM  127 (217)
Q Consensus       117 ~FVGDSl~Rnq  127 (217)
                      +|+|||++-..
T Consensus         1 v~~GDS~t~g~   11 (179)
T PF13472_consen    1 VFLGDSITAGY   11 (179)
T ss_dssp             EEEESHHHHTT
T ss_pred             CEEccccccCC
Confidence            69999999864


No 41 
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism]
Probab=33.02  E-value=30  Score=32.15  Aligned_cols=21  Identities=33%  Similarity=0.548  Sum_probs=18.4

Q ss_pred             hcCCcEEEecchhhHHHHHHHHH
Q 027862          111 YRGKRIMFVGDSLSLNMWESLSC  133 (217)
Q Consensus       111 lrgKrl~FVGDSl~Rnq~~SLlC  133 (217)
                      ++|++++||||-  -|+-.||+-
T Consensus       151 l~g~k~a~vGDg--NNv~nSl~~  171 (310)
T COG0078         151 LKGLKLAYVGDG--NNVANSLLL  171 (310)
T ss_pred             ccCcEEEEEcCc--chHHHHHHH
Confidence            799999999999  788888764


No 42 
>cd04506 SGNH_hydrolase_YpmR_like Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
Probab=32.94  E-value=20  Score=29.31  Aligned_cols=12  Identities=42%  Similarity=0.678  Sum_probs=10.6

Q ss_pred             cEEEecchhhHH
Q 027862          115 RIMFVGDSLSLN  126 (217)
Q Consensus       115 rl~FVGDSl~Rn  126 (217)
                      +|+|+|||++..
T Consensus         1 ~i~~~GDSit~G   12 (204)
T cd04506           1 KIVALGDSLTEG   12 (204)
T ss_pred             CEeEEeccccCc
Confidence            589999999985


No 43 
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]
Probab=32.89  E-value=22  Score=34.80  Aligned_cols=33  Identities=21%  Similarity=0.338  Sum_probs=26.1

Q ss_pred             HHHHHhcCCcEEEecchhhHHH-HHHHHHhhccc
Q 027862          106 DFLRRYRGKRIMFVGDSLSLNM-WESLSCMIHAS  138 (217)
Q Consensus       106 ~fL~~lrgKrl~FVGDSl~Rnq-~~SLlClL~~~  138 (217)
                      .+-+.++||||+.|-||+-|.- ..-++.||+.+
T Consensus       341 pvr~~v~GKrVvlVDDSIVRGTTsr~IV~mlReA  374 (470)
T COG0034         341 PVREVVKGKRVVLVDDSIVRGTTSRRIVQMLREA  374 (470)
T ss_pred             chHHHhCCCeEEEEccccccCccHHHHHHHHHHh
Confidence            4667899999999999998864 55677777744


No 44 
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase. Note that SP|P53981 from S. cerevisiae, a member of this family, is annotated as a "probable membrane protein" due to a predicted transmembrane helix. The region in question contains the second of the three conserved HAD superfamily catalytic motifs and thus, considering the fold of the HAD catalytic domain, is unlikely to be a transmembrane region in fact.
Probab=32.88  E-value=43  Score=26.53  Aligned_cols=13  Identities=23%  Similarity=0.611  Sum_probs=10.8

Q ss_pred             CCcEEEecchhhH
Q 027862          113 GKRIMFVGDSLSL  125 (217)
Q Consensus       113 gKrl~FVGDSl~R  125 (217)
                      .++++|||||.+=
T Consensus       162 ~~~~i~iGD~~~D  174 (188)
T TIGR01489       162 YQHIIYIGDGVTD  174 (188)
T ss_pred             CceEEEECCCcch
Confidence            4689999999874


No 45 
>cd01840 SGNH_hydrolase_yrhL_like yrhL-like subfamily of SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Most members of this sub-family appear to co-occur with N-terminal acyltransferase domains. Might be involved in lipid metabolism.
Probab=31.98  E-value=23  Score=28.03  Aligned_cols=18  Identities=33%  Similarity=0.397  Sum_probs=12.5

Q ss_pred             EEEecchhhHHHHHHHHH
Q 027862          116 IMFVGDSLSLNMWESLSC  133 (217)
Q Consensus       116 l~FVGDSl~Rnq~~SLlC  133 (217)
                      |.|+|||++-..-..|-.
T Consensus         2 v~~~GDSv~~~~~~~~~~   19 (150)
T cd01840           2 ITAIGDSVMLDSSPALQE   19 (150)
T ss_pred             eeEEeehHHHchHHHHHH
Confidence            678999999865444333


No 46 
>PRK01713 ornithine carbamoyltransferase; Provisional
Probab=31.50  E-value=33  Score=31.80  Aligned_cols=25  Identities=24%  Similarity=0.291  Sum_probs=20.1

Q ss_pred             hcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          111 YRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       111 lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      +.|++|+||||-.+ |...|++.++.
T Consensus       154 l~gl~ia~vGD~~~-~v~~Sl~~~~~  178 (334)
T PRK01713        154 LSEISYVYIGDARN-NMGNSLLLIGA  178 (334)
T ss_pred             cCCcEEEEECCCcc-CHHHHHHHHHH
Confidence            67899999999654 48888887774


No 47 
>PF01861 DUF43:  Protein of unknown function DUF43;  InterPro: IPR002723 This family of prokaryotic proteins have not been characterised. All the members are 350-400 amino acids long.; PDB: 2QM3_A.
Probab=30.34  E-value=23  Score=31.78  Aligned_cols=12  Identities=58%  Similarity=1.173  Sum_probs=8.9

Q ss_pred             hcCCcEEEecch
Q 027862          111 YRGKRIMFVGDS  122 (217)
Q Consensus       111 lrgKrl~FVGDS  122 (217)
                      |.||+|.||||-
T Consensus        43 L~gk~il~lGDD   54 (243)
T PF01861_consen   43 LEGKRILFLGDD   54 (243)
T ss_dssp             STT-EEEEES-T
T ss_pred             ccCCEEEEEcCC
Confidence            789999999993


No 48 
>PRK08192 aspartate carbamoyltransferase; Provisional
Probab=28.88  E-value=36  Score=31.67  Aligned_cols=26  Identities=31%  Similarity=0.271  Sum_probs=20.4

Q ss_pred             hcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          111 YRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       111 lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      +.|++|+||||-..-|..-|++.+|.
T Consensus       157 l~g~kia~vGD~~~~rv~~Sl~~~l~  182 (338)
T PRK08192        157 IDGMHIAMVGDLKFGRTVHSLSRLLC  182 (338)
T ss_pred             cCCCEEEEECcCCCCchHHHHHHHHH
Confidence            67899999999754467788877654


No 49 
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase. Ornithine carbamoyltransferases are in the same superfamily and form an outgroup.
Probab=28.16  E-value=38  Score=30.92  Aligned_cols=27  Identities=30%  Similarity=0.306  Sum_probs=21.4

Q ss_pred             HhcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          110 RYRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       110 ~lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      .++|++|+||||-..-|...|++-++.
T Consensus       147 ~l~g~~va~vGD~~~~~v~~Sl~~~~a  173 (301)
T TIGR00670       147 RLDGLKIALVGDLKYGRTVHSLAEALT  173 (301)
T ss_pred             CCCCCEEEEEccCCCCcHHHHHHHHHH
Confidence            478999999999765577788777764


No 50 
>KOG3482 consensus Small nuclear ribonucleoprotein (snRNP) SMF [RNA processing and modification]
Probab=27.19  E-value=54  Score=24.45  Aligned_cols=21  Identities=24%  Similarity=0.374  Sum_probs=17.6

Q ss_pred             CCCCCCChHHHHHHhcCCcEE
Q 027862           97 CAVPRFDGGDFLRRYRGKRIM  117 (217)
Q Consensus        97 C~l~rfd~~~fL~~lrgKrl~  117 (217)
                      |+...-+|+.||..|.||+++
T Consensus         2 ~a~~PvNPKpFL~~l~gk~V~   22 (79)
T KOG3482|consen    2 SAKQPVNPKPFLNGLTGKPVL   22 (79)
T ss_pred             CCcccCCchHHHhhccCCeEE
Confidence            555566999999999999876


No 51 
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional
Probab=27.16  E-value=43  Score=31.14  Aligned_cols=25  Identities=20%  Similarity=0.352  Sum_probs=20.2

Q ss_pred             hcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          111 YRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       111 lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      ++|++|++|||..+ |...|++.++.
T Consensus       154 l~gl~va~vGD~~~-~v~~S~~~~~~  178 (334)
T PRK12562        154 FNEMTLVYAGDARN-NMGNSMLEAAA  178 (334)
T ss_pred             cCCcEEEEECCCCC-CHHHHHHHHHH
Confidence            57899999999764 58888888764


No 52 
>PRK11891 aspartate carbamoyltransferase; Provisional
Probab=26.69  E-value=46  Score=32.18  Aligned_cols=26  Identities=27%  Similarity=0.253  Sum_probs=20.6

Q ss_pred             hcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          111 YRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       111 lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      ++|++|+||||-..-|...|++.++.
T Consensus       239 l~G~kIa~vGD~~~~rv~~Sl~~~la  264 (429)
T PRK11891        239 VDGAHIALVGDLKYGRTVHSLVKLLA  264 (429)
T ss_pred             cCCCEEEEECcCCCChHHHHHHHHHH
Confidence            57899999999864567888887763


No 53 
>PRK10113 cell division modulator; Provisional
Probab=25.54  E-value=33  Score=25.36  Aligned_cols=18  Identities=39%  Similarity=0.599  Sum_probs=13.8

Q ss_pred             HHhcCCcEEEe--cchhhHH
Q 027862          109 RRYRGKRIMFV--GDSLSLN  126 (217)
Q Consensus       109 ~~lrgKrl~FV--GDSl~Rn  126 (217)
                      =.||||-++||  |||.-|.
T Consensus        37 W~LrGKYVAFvl~ge~FrRS   56 (80)
T PRK10113         37 WMLRGKYVAFVLMGESFLRS   56 (80)
T ss_pred             heeccceEEEEEechhhccC
Confidence            35899999986  7777663


No 54 
>PF14647 FAM91_N:  FAM91 N-terminus
Probab=25.53  E-value=67  Score=29.89  Aligned_cols=30  Identities=23%  Similarity=0.367  Sum_probs=24.8

Q ss_pred             CCCCChHHHHHHhcCCcEEEecchhhHHHHHHHHHhhccc
Q 027862           99 VPRFDGGDFLRRYRGKRIMFVGDSLSLNMWESLSCMIHAS  138 (217)
Q Consensus        99 l~rfd~~~fL~~lrgKrl~FVGDSl~Rnq~~SLlClL~~~  138 (217)
                      ||-|.|+|.|+++.          ++||||-.|+--..+.
T Consensus       109 LPNFTAaD~LRllG----------IGRNqYIdlmn~~RS~  138 (308)
T PF14647_consen  109 LPNFTAADCLRLLG----------IGRNQYIDLMNKCRSK  138 (308)
T ss_pred             CCCCcHHHHHHHhc----------chHHHHHHHHHHhchh
Confidence            99999999997663          5699999998876544


No 55 
>PRK14804 ornithine carbamoyltransferase; Provisional
Probab=25.31  E-value=48  Score=30.39  Aligned_cols=25  Identities=20%  Similarity=0.284  Sum_probs=19.9

Q ss_pred             HhcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          110 RYRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       110 ~lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      .++|++|++|||  .-|...|++-++.
T Consensus       150 ~l~g~~va~vGd--~~rv~~Sl~~~~~  174 (311)
T PRK14804        150 PLNQKQLTYIGV--HNNVVNSLIGITA  174 (311)
T ss_pred             CCCCCEEEEECC--CCcHHHHHHHHHH
Confidence            368999999999  3467888887775


No 56 
>PRK00779 ornithine carbamoyltransferase; Provisional
Probab=23.97  E-value=44  Score=30.46  Aligned_cols=26  Identities=27%  Similarity=0.372  Sum_probs=20.6

Q ss_pred             HHhcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          109 RRYRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       109 ~~lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      ..++|++|++||| .+ |-..|++.+|.
T Consensus       148 g~l~gl~i~~vGd-~~-~v~~Sl~~~l~  173 (304)
T PRK00779        148 GSLKGLKVAWVGD-GN-NVANSLLLAAA  173 (304)
T ss_pred             CCcCCcEEEEEeC-CC-ccHHHHHHHHH
Confidence            3478999999999 34 48888888775


No 57 
>CHL00073 chlN photochlorophyllide reductase subunit N
Probab=23.78  E-value=57  Score=31.77  Aligned_cols=28  Identities=39%  Similarity=0.622  Sum_probs=18.9

Q ss_pred             HHHHHhcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          106 DFLRRYRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       106 ~fL~~lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      +..+.++|||++++||+.-   -.||+..|.
T Consensus       307 d~~~~L~GKrvai~Gdp~~---~i~LarfL~  334 (457)
T CHL00073        307 DYLDLVRGKSVFFMGDNLL---EISLARFLI  334 (457)
T ss_pred             HHHHHHCCCEEEEECCCcH---HHHHHHHHH
Confidence            3556689999999999543   334444444


No 58 
>PF09084 NMT1:  NMT1/THI5 like;  InterPro: IPR015168 This entry is found in the NMT1 and THI5 proteins. These proteins are proposed to be required for the biosynthesis of the pyrimidine moiety of thiamine [, , ]. They are regulated by thiamine []. ; PDB: 2X26_A 3E4R_A 3KSJ_A 3KSX_A 3UIF_A 4DDD_A 1US4_A 1US5_A 3IX1_B 2X7P_A ....
Probab=23.54  E-value=70  Score=26.07  Aligned_cols=25  Identities=24%  Similarity=0.170  Sum_probs=19.9

Q ss_pred             HHhcCCcEEEecchhhHHHHHHHHH
Q 027862          109 RRYRGKRIMFVGDSLSLNMWESLSC  133 (217)
Q Consensus       109 ~~lrgKrl~FVGDSl~Rnq~~SLlC  133 (217)
                      +-|+||||++.+.|.+.-.+..++.
T Consensus        89 ~DLkGK~i~v~~~s~~~~~~~~~l~  113 (216)
T PF09084_consen   89 ADLKGKKIGVSRGSSSEYFLRALLK  113 (216)
T ss_dssp             GGGTTSEEEESTTSHHHHHHHHHHH
T ss_pred             HHhCCCEEEEecCcchhHHHHHHHH
Confidence            4479999999998887777776654


No 59 
>PRK07579 hypothetical protein; Provisional
Probab=22.88  E-value=1.5e+02  Score=26.53  Aligned_cols=22  Identities=18%  Similarity=0.238  Sum_probs=17.1

Q ss_pred             CcEEEecchhhHHHHHHHHHhhcc
Q 027862          114 KRIMFVGDSLSLNMWESLSCMIHA  137 (217)
Q Consensus       114 Krl~FVGDSl~Rnq~~SLlClL~~  137 (217)
                      |+|+|+||-  +.+++-+.||+..
T Consensus         2 k~i~~~~~~--~~~~~~~~~~~~~   23 (245)
T PRK07579          2 KTILVLTDN--VHAHALAVDLIAR   23 (245)
T ss_pred             ceEEEEccc--HHHHHHHHHHHhh
Confidence            799999994  5677777787754


No 60 
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase. Most OTCases are homotrimers, but the homotrimers are organized into dodecamers built from four trimers in at least two species; the catabolic OTCase of Pseudomonas aeruginosa is allosterically regulated, while OTCase of the extreme thermophile Pyrococcus furiosus shows both allostery and thermophily.
Probab=22.57  E-value=52  Score=29.98  Aligned_cols=24  Identities=29%  Similarity=0.538  Sum_probs=20.2

Q ss_pred             hcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          111 YRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       111 lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      +.|.+|++|||. + |-..|++.+|.
T Consensus       146 l~g~~v~~vGd~-~-~v~~Sl~~~l~  169 (304)
T TIGR00658       146 LKGVKVVYVGDG-N-NVCNSLMLAGA  169 (304)
T ss_pred             CCCcEEEEEeCC-C-chHHHHHHHHH
Confidence            688999999996 4 58899998875


No 61 
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=22.51  E-value=72  Score=26.67  Aligned_cols=35  Identities=17%  Similarity=0.103  Sum_probs=24.7

Q ss_pred             CCChHHHHHHhcCCcEEEecchhhHHHHHHHHHhhcc
Q 027862          101 RFDGGDFLRRYRGKRIMFVGDSLSLNMWESLSCMIHA  137 (217)
Q Consensus       101 rfd~~~fL~~lrgKrl~FVGDSl~Rnq~~SLlClL~~  137 (217)
                      .-.-.++.+.++||.++|+|-|=.--  -||+-.|..
T Consensus        23 ~~g~~~l~~~l~~k~~vl~G~SGvGK--SSLiN~L~~   57 (161)
T PF03193_consen   23 GEGIEELKELLKGKTSVLLGQSGVGK--SSLINALLP   57 (161)
T ss_dssp             TTTHHHHHHHHTTSEEEEECSTTSSH--HHHHHHHHT
T ss_pred             CcCHHHHHHHhcCCEEEEECCCCCCH--HHHHHHHHh
Confidence            34556889999999999999885443  355555543


No 62 
>PF00657 Lipase_GDSL:  GDSL-like Lipase/Acylhydrolase;  InterPro: IPR001087 A variety of lipolytic enzymes with serine as part of the active site have been identified []. Members of this entry include; Aeromonas hydrophila lipase, Vibrio mimicus arylesterase, Vibrio parahaemolyticus thermolabile haemolysin, rabbit phospholipase (AdRab-B), and Brassica napus anter-specific proline-rich protein.; GO: 0016788 hydrolase activity, acting on ester bonds, 0006629 lipid metabolic process; PDB: 2WAO_A 2WAB_A 1V2G_A 1U8U_A 1JRL_A 1IVN_A 1J00_A 1DEO_A 1K7C_A 1PP4_A ....
Probab=21.85  E-value=48  Score=26.71  Aligned_cols=11  Identities=45%  Similarity=0.643  Sum_probs=10.1

Q ss_pred             EEEecchhhHH
Q 027862          116 IMFVGDSLSLN  126 (217)
Q Consensus       116 l~FVGDSl~Rn  126 (217)
                      |+++|||++-.
T Consensus         1 i~~fGDS~td~   11 (234)
T PF00657_consen    1 IVVFGDSLTDG   11 (234)
T ss_dssp             EEEEESHHHHT
T ss_pred             CEEEeehhccc
Confidence            68999999998


No 63 
>cd01823 SEST_like SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
Probab=21.55  E-value=48  Score=28.17  Aligned_cols=13  Identities=31%  Similarity=0.442  Sum_probs=10.8

Q ss_pred             CcEEEecchhhHH
Q 027862          114 KRIMFVGDSLSLN  126 (217)
Q Consensus       114 Krl~FVGDSl~Rn  126 (217)
                      .+++++|||++-.
T Consensus         1 ~~~v~iGDS~~~G   13 (259)
T cd01823           1 VRYVALGDSYAAG   13 (259)
T ss_pred             CCEEEecchhhcC
Confidence            3789999999865


No 64 
>PF13242 Hydrolase_like:  HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B ....
Probab=21.41  E-value=76  Score=22.11  Aligned_cols=19  Identities=32%  Similarity=0.463  Sum_probs=13.8

Q ss_pred             cCCcEEEecchhhHHHHHH
Q 027862          112 RGKRIMFVGDSLSLNMWES  130 (217)
Q Consensus       112 rgKrl~FVGDSl~Rnq~~S  130 (217)
                      .-.++++||||+..-+--+
T Consensus        20 ~~~~~~~VGD~~~~Di~~a   38 (75)
T PF13242_consen   20 DPSRCVMVGDSLETDIEAA   38 (75)
T ss_dssp             GGGGEEEEESSTTTHHHHH
T ss_pred             CHHHEEEEcCCcHhHHHHH
Confidence            3468999999977665433


No 65 
>PRK02255 putrescine carbamoyltransferase; Provisional
Probab=20.34  E-value=78  Score=29.45  Aligned_cols=24  Identities=25%  Similarity=0.476  Sum_probs=19.8

Q ss_pred             hcCCcEEEecchhhHHHHHHHHHhhc
Q 027862          111 YRGKRIMFVGDSLSLNMWESLSCMIH  136 (217)
Q Consensus       111 lrgKrl~FVGDSl~Rnq~~SLlClL~  136 (217)
                      +.|++|++|||- + |...|++.++.
T Consensus       152 l~glkv~~vGD~-~-~v~~Sl~~~~~  175 (338)
T PRK02255        152 LEDCKVVFVGDA-T-QVCVSLMFIAT  175 (338)
T ss_pred             CCCCEEEEECCC-c-hHHHHHHHHHH
Confidence            678999999995 3 68899888874


Done!