Query         027886
Match_columns 217
No_of_seqs    113 out of 124
Neff          3.8 
Searched_HMMs 46136
Date          Fri Mar 29 02:57:32 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/027886.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/027886hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04927 SMP:  Seed maturation   99.8 1.5E-20 3.1E-25  136.3   6.5   62   92-153     1-62  (62)
  2 PF04927 SMP:  Seed maturation   99.8 7.8E-20 1.7E-24  132.5   4.9   59  157-216     1-59  (62)
  3 cd07046 BMC_PduU-EutS 1,2-prop  22.6      58  0.0013   26.2   1.8   23   59-81      1-24  (110)
  4 PF12218 End_N_terminal:  N ter  10.8   2E+02  0.0044   21.6   2.0   31   43-73     26-61  (67)
  5 PF11005 DUF2844:  Protein of u  10.1 2.9E+02  0.0063   23.0   2.9   25   43-68     27-51  (132)
  6 PRK10386 curli assembly protei   9.8 4.4E+02  0.0095   22.0   3.8   35   44-79     56-91  (130)
  7 PRK15468 carboxysome structura   7.6 2.2E+02  0.0049   23.3   1.2   78   59-148     4-94  (111)
  8 smart00685 DM14 Repeats in fly   5.8 4.6E+02    0.01   19.0   1.9   19   94-115    36-54  (59)
  9 TIGR03687 pupylate_cterm ubiqu   5.3 2.1E+02  0.0045   18.9  -0.1   14    3-16     19-32  (33)
 10 cd01208 X11 X11 Phosphotyrosin   4.7 3.9E+02  0.0085   23.0   1.1   13   92-104   136-148 (156)

No 1  
>PF04927 SMP:  Seed maturation protein;  InterPro: IPR007011 Late embryogenesis abundant (LEA) proteins accumulate to high levels during the last stage of seed formation (when a natural desiccation of the seed tissues takes place) and during periods of water deficit in vegetative organs. LEA proteins have been grouped into at least six families on the basis of sequence similarity. Although significant similarity has not been detected between the members of the different classes, a unifying and outstanding feature of these proteins is their high hydrophilicity and high percentage of glycines. Amino acid sequence analysis allows one to predict that these proteins exist primarily as random coils. This property has been confirmed in few cases with purified proteins and is supported by the fact that proteins of this type do not coagulate upon heating. LEA protein families have been identified in a wide range of different plant species to the extent that they can be considered ubiquitous in plants. Moreover, it has been shown that members of at least one of the LEA protein families, the so-called dehydrins, are present in a range of photosynthetic organisms, including lower plants, algae, and cyanobacteria. In addition similar proteins, the hydrophilins are induced in a variety of different taxons, of non-photosynthetic organsims, in response to osmotic stress. All of these proteins have a high hydrophilicity index, generally greater than 1.0 []. This conserved region identifies a set of plant seed maturation proteins described as LEA D34.
Probab=99.82  E-value=1.5e-20  Score=136.34  Aligned_cols=62  Identities=52%  Similarity=0.659  Sum_probs=59.0

Q ss_pred             CchHhHHHHHhhhhhcCCCCChhHHHHHHHHHHhhccCCCCCCCcHHHHHhhHHHhcccccC
Q 027886           92 QSTIGEALEATALSAGDKAVDQRDAAAIYAAEARASATNEIKPGGIGSRAQSAATQNERTTF  153 (217)
Q Consensus        92 ~itiGealeaaa~~~g~kPV~~~DAAaiqaAE~ratG~~~~~~GG~AA~aQsAA~~N~r~~~  153 (217)
                      +|||||+|++++..+++|||+++||+.||+||+|.+|.+.++|||++++||||+++|++.++
T Consensus         1 ~vt~gdvl~A~a~~~~~kpVt~eDAa~iqsAE~r~~g~~~~~~GGvAa~~qsAA~~N~~~~~   62 (62)
T PF04927_consen    1 KVTIGDVLEAAAGLPGDKPVTPEDAAAIQSAEARATGGAQTQPGGVAAAAQSAADKNERAGR   62 (62)
T ss_pred             CccHHHHHHHHhcccccCCCCHHHHHHHHHHHHhhCCCCCCCCCCHHHHHHHHHHHhhhccC
Confidence            59999999988888999999999999999999999999889999999999999999998764


No 2  
>PF04927 SMP:  Seed maturation protein;  InterPro: IPR007011 Late embryogenesis abundant (LEA) proteins accumulate to high levels during the last stage of seed formation (when a natural desiccation of the seed tissues takes place) and during periods of water deficit in vegetative organs. LEA proteins have been grouped into at least six families on the basis of sequence similarity. Although significant similarity has not been detected between the members of the different classes, a unifying and outstanding feature of these proteins is their high hydrophilicity and high percentage of glycines. Amino acid sequence analysis allows one to predict that these proteins exist primarily as random coils. This property has been confirmed in few cases with purified proteins and is supported by the fact that proteins of this type do not coagulate upon heating. LEA protein families have been identified in a wide range of different plant species to the extent that they can be considered ubiquitous in plants. Moreover, it has been shown that members of at least one of the LEA protein families, the so-called dehydrins, are present in a range of photosynthetic organisms, including lower plants, algae, and cyanobacteria. In addition similar proteins, the hydrophilins are induced in a variety of different taxons, of non-photosynthetic organsims, in response to osmotic stress. All of these proteins have a high hydrophilicity index, generally greater than 1.0 []. This conserved region identifies a set of plant seed maturation proteins described as LEA D34.
Probab=99.79  E-value=7.8e-20  Score=132.55  Aligned_cols=59  Identities=47%  Similarity=0.628  Sum_probs=57.3

Q ss_pred             cchhhhhhhhccccCCCCCCCCHhhHhhhhchhhhcCCCCCCCCCcHHHHHHHHHHhccC
Q 027886          157 KITISDVSGDATTKLSDDKPVTREDAEGIISPEIRNKPDMRTTPGGVASSMAAAARLNQS  216 (217)
Q Consensus       157 kitigdvL~~At~kl~~Dk~vt~eDAaaV~aAE~R~~g~~~~~pGGVAaa~qaAA~~N~~  216 (217)
                      |||||||| +|+.++++|||||+|||++||+||+|++|...+.||||+++||+||++|++
T Consensus         1 ~vt~gdvl-~A~a~~~~~kpVt~eDAa~iqsAE~r~~g~~~~~~GGvAa~~qsAA~~N~~   59 (62)
T PF04927_consen    1 KVTIGDVL-EAAAGLPGDKPVTPEDAAAIQSAEARATGGAQTQPGGVAAAAQSAADKNER   59 (62)
T ss_pred             CccHHHHH-HHHhcccccCCCCHHHHHHHHHHHHhhCCCCCCCCCCHHHHHHHHHHHhhh
Confidence            69999999 999999999999999999999999999999889999999999999999986


No 3  
>cd07046 BMC_PduU-EutS 1,2-propanediol utilization protein U (PduU)/ethanolamine utilization protein S (EutS), Bacterial Micro-Compartment (BMC) domain. PduU encapsulates several related enzymes within a shell composed of a few thousand protein subunits.  PduU exists as a hexamer which might further assemble into the flat facets of the polyhedral outer shell of the pdu organelle. This proteinaceous noncarboxysome microcompartment is involved in coenzyme B12-dependent degradation of 1,2-propanediol. The core of PduU is related to the typical BMC domain and its natural oligomeric state is a cyclic hexamer. Unlike other typical BMC domain proteins, the 3D topology of PduU reveals a circular permuted variation on the typical BMC fold which leads to several unique features. The exact functions related to those unique features are still not clear. Another difference is the presence of a deep cavity on one side of the hexamer as well as an intermolecular six-stranded beta barrel that seems to 
Probab=22.63  E-value=58  Score=26.21  Aligned_cols=23  Identities=22%  Similarity=0.209  Sum_probs=19.8

Q ss_pred             CeeEeeeecc-eeceeeccCCCCc
Q 027886           59 NRIITEAIGD-QVLAQYATPEVPT   81 (217)
Q Consensus        59 ~RivTE~VaG-QVvgq~~~p~~~~   81 (217)
                      .|||-|+|.| |++..|+-|.+..
T Consensus         1 ~r~~~~~v~gk~i~~~~vI~~v~~   24 (110)
T cd07046           1 QRIIQEYVPGKQITLAHLIANPDP   24 (110)
T ss_pred             CcceEEecCcceEEEEEEecCCCH
Confidence            3899999988 8999999998854


No 4  
>PF12218 End_N_terminal:  N terminal extension of bacteriophage endosialidase;  InterPro: IPR024429 This entry represents the N-terminal extension domain of endosialidases which is approximately 70 amino acids in length. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain [].; PDB: 3JU4_A 3GVL_A 3GVK_B 3GVJ_A 1V0E_B 1V0F_E.
Probab=10.83  E-value=2e+02  Score=21.63  Aligned_cols=31  Identities=29%  Similarity=0.333  Sum_probs=17.9

Q ss_pred             ccCCCeeeEecccCC-----CCeeEeeeecceecee
Q 027886           43 ARDQGVTVSESTVAD-----GNRIITEAIGDQVLAQ   73 (217)
Q Consensus        43 a~d~GV~VtEt~vp~-----G~RivTE~VaGQVvgq   73 (217)
                      ....|.+-.-+.+|+     ..|++-|.+.||++--
T Consensus        26 IDg~GlTykVs~lPd~srf~N~rF~~eri~gqpl~y   61 (67)
T PF12218_consen   26 IDGAGLTYKVSSLPDISRFKNARFVYERIPGQPLYY   61 (67)
T ss_dssp             EE-TT-EEEESS---GGGEES-EEEE-SSTT--EEE
T ss_pred             EecCCceEEEeeCccHHhhccceEEEeecCCCceEe
Confidence            447788888888997     6799999999998753


No 5  
>PF11005 DUF2844:  Protein of unknown function (DUF2844);  InterPro: IPR021267  This bacterial family of proteins has no known function. 
Probab=10.08  E-value=2.9e+02  Score=22.98  Aligned_cols=25  Identities=24%  Similarity=0.238  Sum_probs=21.6

Q ss_pred             ccCCCeeeEecccCCCCeeEeeeecc
Q 027886           43 ARDQGVTVSESTVADGNRIITEAIGD   68 (217)
Q Consensus        43 a~d~GV~VtEt~vp~G~RivTE~VaG   68 (217)
                      .....++|.|+..+ +...|.|++..
T Consensus        27 ~~~~~ytv~~~t~~-~Gt~VrEY~~~   51 (132)
T PF11005_consen   27 TSAAAYTVRETTDA-SGTTVREYVTP   51 (132)
T ss_pred             cCCCceEEEEEEcC-CCcEEEEEEcC
Confidence            45789999999999 88889999875


No 6  
>PRK10386 curli assembly protein CsgE; Provisional
Probab=9.77  E-value=4.4e+02  Score=22.03  Aligned_cols=35  Identities=26%  Similarity=0.243  Sum_probs=28.4

Q ss_pred             cCCCeeeEecccCC-CCeeEeeeecceeceeeccCCC
Q 027886           44 RDQGVTVSESTVAD-GNRIITEAIGDQVLAQYATPEV   79 (217)
Q Consensus        44 ~d~GV~VtEt~vp~-G~RivTE~VaGQVvgq~~~p~~   79 (217)
                      -+..|+|.|..-|. |. +||=.+..+||-|+..++.
T Consensus        56 ~~~nltI~E~p~a~~GS-~ItV~~n~~vIy~t~l~p~   91 (130)
T PRK10386         56 YDGNLTINERPSARWGS-WITITVNQDVIYQTFLFPN   91 (130)
T ss_pred             CCCcEEEEEEEcCCCCc-EEEEEECCEEEEEEecCcc
Confidence            35789999998886 55 7888999999999887644


No 7  
>PRK15468 carboxysome structural protein EutS; Provisional
Probab=7.56  E-value=2.2e+02  Score=23.34  Aligned_cols=78  Identities=21%  Similarity=0.223  Sum_probs=41.1

Q ss_pred             CeeEeeeecc-eeceeeccCCCCccCCCcccCCCCchHhHHHHHhhhhhcCCCCChhHHHHHHH------HHH------h
Q 027886           59 NRIITEAIGD-QVLAQYATPEVPTRASGAALGRDQSTIGEALEATALSAGDKAVDQRDAAAIYA------AEA------R  125 (217)
Q Consensus        59 ~RivTE~VaG-QVvgq~~~p~~~~~~~~~a~~~~~itiGealeaaa~~~g~kPV~~~DAAaiqa------AE~------r  125 (217)
                      .|||-|+|-| ||---.+-..|....-.        ++|  |+.. .++|==-|+|++++-|.+      +..      |
T Consensus         4 ~RiIQE~VPGKQvTlAHiIa~P~~~iy~--------klG--l~~~-~AIGIlTiTP~E~aIIAaDIA~Kaa~V~igF~DR   72 (111)
T PRK15468          4 ERIIQEFVPGKQVTLAHLIAHPGEELAK--------KIG--VPDA-GAIGIMTLTPGETAMIAGDLALKAADVHIGFLDR   72 (111)
T ss_pred             cceEEeecCCceeeeeeeecCCcHHHHH--------HhC--CCcc-CceEEEEeCcchHHHHHHHhhhhccCcEEeeeec
Confidence            4899999988 77655554433211000        000  1111 145556677777765543      221      3


Q ss_pred             hccCCCCCCCcHHHHHhhHHHhc
Q 027886          126 ASATNEIKPGGIGSRAQSAATQN  148 (217)
Q Consensus       126 atG~~~~~~GG~AA~aQsAA~~N  148 (217)
                      .+| ...+-|.++++..+--..+
T Consensus        73 FsG-slvitGdvs~Ve~Al~~V~   94 (111)
T PRK15468         73 FSG-ALVIYGSVGAVEEALSQTV   94 (111)
T ss_pred             cce-eEEEEccHHHHHHHHHHHH
Confidence            444 3346777877766655554


No 8  
>smart00685 DM14 Repeats in fly CG4713, worm Y37H9A.3 and human FLJ20241.
Probab=5.79  E-value=4.6e+02  Score=19.02  Aligned_cols=19  Identities=21%  Similarity=0.443  Sum_probs=13.1

Q ss_pred             hHhHHHHHhhhhhcCCCCChhH
Q 027886           94 TIGEALEATALSAGDKAVDQRD  115 (217)
Q Consensus        94 tiGealeaaa~~~g~kPV~~~D  115 (217)
                      +|.++++++-   .++||+.++
T Consensus        36 ~~~~~I~~~~---aG~pVd~~~   54 (59)
T smart00685       36 QFDDAIKAAR---AGRPVDLSE   54 (59)
T ss_pred             hHHHHHHHHH---CCCCCChhc
Confidence            4666776653   579998875


No 9  
>TIGR03687 pupylate_cterm ubiquitin-like protein Pup. Members of this protein family are Pup, a small protein whose ligation to target proteins steers them toward degradation. This protein family occurs in a number of bacteria, especially Actinobacteria such as Mycobacterium tuberculosis, that possess an archeal-type proteasome. All members of this protein family known during model construction end with the C-terminal motif [FY][VI]QKGG[QE]. Ligation is thought to occur between the C-terminal COOH of Pup and an epsilon-amino group of a Lys on the target protein. The N-terminal half of this protein is poorly conserved and not represented in the seed alignment.
Probab=5.34  E-value=2.1e+02  Score=18.91  Aligned_cols=14  Identities=43%  Similarity=0.667  Sum_probs=11.7

Q ss_pred             hhhhhhhcccCCCC
Q 027886            3 AAENMALGKTQRGG   16 (217)
Q Consensus         3 sAE~~v~G~tqkgG   16 (217)
                      .||.-|-|-.||||
T Consensus        19 NAe~FV~~fVQKGG   32 (33)
T TIGR03687        19 NAEEFVRGFVQKGG   32 (33)
T ss_pred             hHHHHHHHHHHccC
Confidence            47888888899998


No 10 
>cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain. X11 Phosphotyrosine-binding (PTB) domain. The neuronal protein X11 has a PTB domain followed by two PDZ domains. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues.  In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether. X11 binds to the cytoplasmic domain of the beta-amyloid precursor protein (beta-APP) and does not require the substrate to be tyrosine-phosphorylated for binding.
Probab=4.71  E-value=3.9e+02  Score=22.98  Aligned_cols=13  Identities=23%  Similarity=0.432  Sum_probs=10.4

Q ss_pred             CchHhHHHHHhhh
Q 027886           92 QSTIGEALEATAL  104 (217)
Q Consensus        92 ~itiGealeaaa~  104 (217)
                      ..|||+||+.+=+
T Consensus       136 a~TIGQAF~lAY~  148 (156)
T cd01208         136 AQSIGQAFQVAYQ  148 (156)
T ss_pred             HHHHHHHHHHHHH
Confidence            4699999998743


Done!