Citrus Sinensis ID: 027933


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MGHHRSCKNGLWKPIGVTISYLAVPFNVSFRARSFFVPNSRKMTTIRRFCCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRIMGYIMGKVEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIKMYEKLGYVIYRRVLRYYSGEEDGLDMRKALSRDVEKKSIIPLKRPVTPDELEYD
cccccccccccccccHHHHHcccccccccccccccccccccccEEEEEcccccHHHHHHHHcccccccccHHHHHHHHHcccccEEEEEcccccEEEEEEEEECcccccccCEEEEEECccccccccHHHHHHHHHHHHHHcccccEEEEEEEEcccHHHHHHHHHcccEEEEEEEccccccccHHHHHHcccccccccccccccccccccccccc
********NGLWKPIGVTISYLAVPFNVSFRARSFFVPNSRKMTTIRRFCCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRIMGYIMGKVEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIKMYEKLGYVIYRRVLRYYSGEEDGLDMRKALSRD*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGHHRSCKNGLWKPIGVTISYLAVPFNVSFRARSFFVPNSRKMTTIRRFCCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRIMGYIMGKVEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIKMYEKLGYVIYRRVLRYYSGEEDGLDMRKALSRDVEKKSIIPLKRPVTPDELEYD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized N-acetyltransferase C16C4.12 probableO74457
N-alpha-acetyltransferase 20 Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp-Glu. May play a role in normal cell-cycle progression.probableQ58ED9
N-alpha-acetyltransferase 20 Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp-Glu. May play a role in normal cell-cycle progression.probableQ6P632

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.88Peptide alpha-N-acetyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X7B, chain A
Confidence level:very confident
Coverage over the Query: 43-191
View the alignment between query and template
View the model in PyMOL
Template: 3LD2, chain A
Confidence level:confident
Coverage over the Query: 45-193
View the alignment between query and template
View the model in PyMOL