Citrus Sinensis ID: 027983

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MATSFNNAKFTVPVNDVEHQTTIATTTLELDETSKDFDYSKRSQWLRAAVLGANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIQVAQLKRNRDQGNTGGVTEEKEEEEGLPSPIQAAAASALAFSLASFIRDYKIRLGVVVAAVTLALAVFGWLGAVLGKAPVVRSAVRVLVGGWLAMAITFGLTKLIGSSGL
ccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccc
******************************************SQWLRAAVLGANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIQVAQLKRNRDQGNTGGVTEEKEEEEGLPSPIQAAAASALAFSLASFIRDYKIRLGVVVAAVTLALAVFGWLGAVLGKAPVVRSAVRVLVGGWLAMAITFGLTKLIGSSGL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSFNNAKFTVPVNDVEHQTTIATTTLELDETSKDFDYSKRSQWLRAAVLGANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIQVAQLKRNRDQGNTGGVTEEKEEEEGLPSPIQAAAASALAFSLASFIRDYKIRLGVVVAAVTLALAVFGWLGAVLGKAPVVRSAVRVLVGGWLAMAITFGLTKLIGSSGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar iron transporter homolog 4 Probable vacuolar iron transporter that may be involved in the regulation of iron distribution throughout the plant.confidentQ9M2C0
Vacuolar iron transporter homolog 1 Probable vacuolar iron transporter that may be involved in the regulation of iron distribution throughout the plant.probableQ6H658
Vacuolar iron transporter homolog 5 Probable vacuolar iron transporter that may be involved in the regulation of iron distribution throughout the plant.probableQ7XTL7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted