Citrus Sinensis ID: 027988


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MGTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSLAKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFAFPYIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLLRSGKLEEKYQPTIKVSQERAKSLGINFTPWEVGVRGCIESLMEKGFLS
ccHHHHHHHHHHcccccEEEEEcccEEEEcccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHccccccccccEEEEHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHcccccccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHccccc
ccHHHHHHHHHHccccEEEEEEcccEEEEcccccccccEEEcccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHccccEEEEcccEEEcccccccccHHHHHHHHHHcccccccccccEEEHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHccccccccccccccccEEEEcHHHHHHcccEEccHHHHHHHHHHHHHHccccc
MGTLNVLRSCAKVHSIKRVVLTSSIgamllnetpmtpdvvidetwfsnpvlckenKEWYSLAKTLAEEAAWKFAKENgidlvaihpgtvigpffqpiLNFGAEVILNLIngdqsfafpyIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYptllrsgkleekyqptIKVSQERAKslginftpwevgVRGCIESLMEKGFLS
mgtlnvlrscakvhsikrVVLTssigamllnetPMTPDVVIDETWFSNPVLCKENKEWYSLAKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFAFPYIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLlrsgkleekyqpTIKVSqerakslginftpwevgvRGCIESLMEKGFLS
MGTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSLAKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFAFPYIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLLRSGKLEEKYQPTIKVSQERAKSLGINFTPWEVGVRGCIESLMEKGFLS
****NVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSLAKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFAFPYIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLLRSGKLEEKYQPTIKVSQERAKSLGINFTPWEVGVRGCIESLM******
MGTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSLAKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFAFPYIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLLRSGKLEEKYQPTIKVSQERAKSLGINFTPWEVGVRGCIESLMEKGFLS
MGTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSLAKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFAFPYIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLLRSGKLEEKYQPTIKVSQERAKSLGINFTPWEVGVRGCIESLMEKGFLS
MGTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSLAKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFAFPYIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLLRSGKLEEKYQPTIKVSQERAKSLGINFTPWEVGVRGCIESLMEK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSLAKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFAFPYIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLLRSGKLEEKYQPTIKVSQERAKSLGINFTPWEVGVRGCIESLMEKGFLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query216 2.2.26 [Sep-21-2011]
Q500U8326 Tetraketide alpha-pyrone no no 0.990 0.656 0.394 1e-35
Q9S9N9344 Cinnamoyl-CoA reductase 1 no no 0.925 0.581 0.368 1e-28
Q9CA28321 Tetraketide alpha-pyrone no no 0.976 0.657 0.373 6e-28
Q9SAH9332 Cinnamoyl-CoA reductase 2 no no 0.981 0.638 0.347 1e-25
P51110337 Dihydroflavonol-4-reducta no no 0.976 0.626 0.336 5e-24
Q9XES5348 Bifunctional dihydroflavo N/A no 0.967 0.600 0.324 4e-22
Q84KP0347 Bifunctional dihydroflavo N/A no 0.967 0.602 0.32 1e-21
P14721 446 Dihydroflavonol-4-reducta N/A no 0.976 0.473 0.322 2e-20
P51104360 Dihydroflavonol-4-reducta N/A no 0.953 0.572 0.334 3e-20
P14720380 Dihydroflavonol-4-reducta N/A no 0.972 0.552 0.308 1e-19
>sp|Q500U8|TKPR1_ARATH Tetraketide alpha-pyrone reductase 1 OS=Arabidopsis thaliana GN=TKPR1 PE=2 SV=1 Back     alignment and function desciption
 Score =  149 bits (376), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 127/218 (58%), Gaps = 4/218 (1%)

Query: 2   GTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSL 61
           GTLNVLRSC K  S+KRVVLTSS   + + +    P + +DE+ +++  LCK  + WY+L
Sbjct: 106 GTLNVLRSCRKNPSLKRVVLTSSSSTVRIRDD-FDPKIPLDESIWTSVELCKRFQVWYAL 164

Query: 62  AKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGD-QSFAF--P 118
           +KTLAE+AAWKF++ENGIDLV + P  ++GP   P L   A  +L L+ G+ + F +   
Sbjct: 165 SKTLAEQAAWKFSEENGIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQ 224

Query: 119 YIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLLRSGKLEEKYQ 178
             +V I DV   HI   E   A GRY+ + +V    +++ FL   YP+L    + E+  +
Sbjct: 225 MGYVHIDDVARTHIVVFEHEAAQGRYICSSNVISLEELVSFLSARYPSLPIPKRFEKLNR 284

Query: 179 PTIKVSQERAKSLGINFTPWEVGVRGCIESLMEKGFLS 216
                   + +SLG+ F   E     CI SL+E+G+LS
Sbjct: 285 LHYDFDTSKIQSLGLKFKSLEEMFDDCIASLVEQGYLS 322




Involved in the biosynthesis of hydroxylated tetraketide compounds that serve as sporopollenin precursors (the main constituents of exine). Is essential for pollen wall development. Acts on tetraketide alpha-pyrones and reduces the carbonyl function on the tetraketide alkyl chain to a secondary alcohol function.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9S9N9|CCR1_ARATH Cinnamoyl-CoA reductase 1 OS=Arabidopsis thaliana GN=CCR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9CA28|TKPR2_ARATH Tetraketide alpha-pyrone reductase 2 OS=Arabidopsis thaliana GN=TKPR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SAH9|CCR2_ARATH Cinnamoyl-CoA reductase 2 OS=Arabidopsis thaliana GN=CCR2 PE=1 SV=1 Back     alignment and function description
>sp|P51110|DFRA_VITVI Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|Q9XES5|DFRA_MALDO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|Q84KP0|DFRA_PYRCO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|P14721|DFRA_ANTMA Dihydroflavonol-4-reductase OS=Antirrhinum majus GN=DFRA PE=2 SV=1 Back     alignment and function description
>sp|P51104|DFRA_DIACA Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1 Back     alignment and function description
>sp|P14720|DFRA_PETHY Dihydroflavonol-4-reductase OS=Petunia hybrida GN=DFRA PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
255553494 324 cinnamoyl-CoA reductase, putative [Ricin 0.995 0.663 0.582 4e-66
359486990 323 PREDICTED: LOW QUALITY PROTEIN: bifuncti 0.981 0.656 0.570 2e-65
255553474 324 cinnamoyl-CoA reductase, putative [Ricin 0.995 0.663 0.577 3e-65
224106117 341 cinnamoyl CoA reductase-like protein [Po 0.990 0.627 0.572 3e-65
225470855 326 PREDICTED: bifunctional dihydroflavonol 0.995 0.659 0.570 7e-65
157365234301 cinnamyl alcohol dehydrogenase 2 [Eriobo 0.972 0.697 0.576 1e-64
225470851 326 PREDICTED: bifunctional dihydroflavonol 0.995 0.659 0.570 1e-64
225455496 324 PREDICTED: dihydroflavonol-4-reductase [ 0.995 0.663 0.582 4e-64
255553468 666 cinnamoyl-CoA reductase, putative [Ricin 0.990 0.321 0.580 5e-64
408777393 326 cinnamyl alcohol dehydrogenase [Punica g 0.976 0.647 0.558 9e-64
>gi|255553494|ref|XP_002517788.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223543060|gb|EEF44595.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 162/218 (74%), Gaps = 3/218 (1%)

Query: 2   GTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSL 61
           GTLNVL+SCAKV S+KRVV+TSS+ A+L +  P+T DVV+DETW+S+P +CKE K WY+L
Sbjct: 106 GTLNVLKSCAKVKSVKRVVITSSMAAVLRSRRPLTADVVVDETWYSDPEVCKELKVWYAL 165

Query: 62  AKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFAFPYI- 120
           +KTLAEEAAW FAKEN IDLV I+P  VIGP  QP LN   E+ILNLI G +++   Y  
Sbjct: 166 SKTLAEEAAWNFAKENAIDLVTINPTYVIGPMLQPTLNSSVEMILNLIKGAETYPNAYYS 225

Query: 121 FVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLLRSGKLEEK--YQ 178
             +IRDVV  HI+A EVP ASGRY +  +V  +S+++K + EHYPTL    K +E     
Sbjct: 226 SADIRDVVDVHIQAFEVPSASGRYCVVPNVLHYSEVVKIIHEHYPTLHLPEKCDETQLLS 285

Query: 179 PTIKVSQERAKSLGINFTPWEVGVRGCIESLMEKGFLS 216
           P+ KVS E+AKSLGIN+ P+EV ++G IESL EKGFL+
Sbjct: 286 PSFKVSNEKAKSLGINYIPFEVTLKGTIESLKEKGFLT 323




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359486990|ref|XP_003633502.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255553474|ref|XP_002517778.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223543050|gb|EEF44585.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224106117|ref|XP_002314050.1| cinnamoyl CoA reductase-like protein [Populus trichocarpa] gi|222850458|gb|EEE88005.1| cinnamoyl CoA reductase-like protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225470855|ref|XP_002268322.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [Vitis vinifera] gi|298205076|emb|CBI40597.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|157365234|gb|ABV44811.1| cinnamyl alcohol dehydrogenase 2 [Eriobotrya japonica] Back     alignment and taxonomy information
>gi|225470851|ref|XP_002268122.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [Vitis vinifera] gi|298205080|emb|CBI40601.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225455496|ref|XP_002263014.1| PREDICTED: dihydroflavonol-4-reductase [Vitis vinifera] gi|296086795|emb|CBI32944.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255553468|ref|XP_002517775.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223543047|gb|EEF44582.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|408777393|gb|AFU90744.1| cinnamyl alcohol dehydrogenase [Punica granatum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
TAIR|locus:2150315326 AT5G19440 [Arabidopsis thalian 0.986 0.653 0.541 2.8e-57
TAIR|locus:2033904325 AT1G51410 [Arabidopsis thalian 0.990 0.658 0.511 2.6e-54
TAIR|locus:2012250369 AT1G09480 [Arabidopsis thalian 0.990 0.579 0.479 2.8e-50
TAIR|locus:2012280325 AT1G09500 [Arabidopsis thalian 0.976 0.649 0.490 3.6e-50
TAIR|locus:2012315322 AT1G09510 [Arabidopsis thalian 0.976 0.655 0.5 7.4e-50
TAIR|locus:2012265322 AT1G09490 [Arabidopsis thalian 0.990 0.664 0.465 1.1e-48
TAIR|locus:2033394319 AT1G66800 [Arabidopsis thalian 0.972 0.658 0.502 2e-47
TAIR|locus:2122093326 DRL1 "dihydroflavonol 4-reduct 0.990 0.656 0.394 6.5e-35
TAIR|locus:2056171318 AT2G02400 [Arabidopsis thalian 0.972 0.660 0.372 5.8e-34
TAIR|locus:2200427344 CCR1 "cinnamoyl coa reductase 0.986 0.619 0.359 9.5e-34
TAIR|locus:2150315 AT5G19440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 589 (212.4 bits), Expect = 2.8e-57, P = 2.8e-57
 Identities = 117/216 (54%), Positives = 153/216 (70%)

Query:     2 GTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSL 61
             GTLNVL SCAK  S+KRVV+TSS+ A+  N  P TPDV +DETWFS+P LC+ +K WY L
Sbjct:   108 GTLNVLNSCAKASSVKRVVVTSSMAAVGYNGKPRTPDVTVDETWFSDPELCEASKMWYVL 167

Query:    62 AKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFA-FPYI 120
             +KTLAE+AAWK AKE G+D+V I+P  VIGP  QP LN  A  ILNLING ++F    + 
Sbjct:   168 SKTLAEDAAWKLAKEKGLDIVTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFPNLSFG 227

Query:   121 FVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTL-LRSGKLEEK-YQ 178
             +V ++DV  AHI+A EVP A+GRY L   V  HS+I+  LRE YP L L    ++E  Y 
Sbjct:   228 WVNVKDVANAHIQAFEVPSANGRYCLVERVVHHSEIVNILRELYPNLPLPERCVDENPYV 287

Query:   179 PTIKVSQERAKSLGINFTPWEVGVRGCIESLMEKGF 214
             PT +VS+++ +SLGI++ P +V ++  +ESL EKGF
Sbjct:   288 PTYQVSKDKTRSLGIDYIPLKVSIKETVESLKEKGF 323




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0044237 "cellular metabolic process" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0004022 "alcohol dehydrogenase (NAD) activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0046482 "para-aminobenzoic acid metabolic process" evidence=RCA
TAIR|locus:2033904 AT1G51410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012250 AT1G09480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012280 AT1G09500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012315 AT1G09510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012265 AT1G09490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033394 AT1G66800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122093 DRL1 "dihydroflavonol 4-reductase-like1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056171 AT2G02400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200427 CCR1 "cinnamoyl coa reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
PLN02662322 PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase 1e-116
PLN02986322 PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase 6e-71
cd08958293 cd08958, FR_SDR_e, flavonoid reductase (FR), exten 2e-70
PLN02989325 PLN02989, PLN02989, cinnamyl-alcohol dehydrogenase 3e-68
cd05227301 cd05227, AR_SDR_e, aldehyde reductase, extended (e 9e-44
PLN02214342 PLN02214, PLN02214, cinnamoyl-CoA reductase 1e-38
cd05193295 cd05193, AR_like_SDR_e, aldehyde reductase, flavon 8e-37
PLN02896353 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase 9e-36
PLN02650351 PLN02650, PLN02650, dihydroflavonol-4-reductase 6e-30
PLN00198338 PLN00198, PLN00198, anthocyanidin reductase; Provi 4e-29
PLN02583297 PLN02583, PLN02583, cinnamoyl-CoA reductase 8e-26
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 1e-20
PLN02686367 PLN02686, PLN02686, cinnamoyl-CoA reductase 2e-19
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 1e-16
cd08946200 cd08946, SDR_e, extended (e) SDRs 1e-14
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimera 4e-12
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 1e-10
cd05241331 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid d 5e-07
cd05256304 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-e 5e-07
cd05257316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 1e-06
cd05232303 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, 3e-04
>gnl|CDD|178268 PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
 Score =  332 bits (854), Expect = e-116
 Identities = 135/222 (60%), Positives = 164/222 (73%), Gaps = 11/222 (4%)

Query: 2   GTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSL 61
           GTLNVLRSCAKV S+KRVV+TSS+ A+  N  P+TPDVV+DETWFS+P  C+E+K WY L
Sbjct: 105 GTLNVLRSCAKVPSVKRVVVTSSMAAVAYNGKPLTPDVVVDETWFSDPAFCEESKLWYVL 164

Query: 62  AKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFA-FPYI 120
           +KTLAEEAAWKFAKENGID+V I+P  VIGP  QP LN  AE ILNLING Q+F    Y 
Sbjct: 165 SKTLAEEAAWKFAKENGIDMVTINPAMVIGPLLQPTLNTSAEAILNLINGAQTFPNASYR 224

Query: 121 FVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLLRSGKLEEK---- 176
           +V++RDV  AHI+A E+P ASGRY L   V  +S+++K L E YPTL    +L EK    
Sbjct: 225 WVDVRDVANAHIQAFEIPSASGRYCLVERVVHYSEVVKILHELYPTL----QLPEKCADD 280

Query: 177 --YQPTIKVSQERAKSLGINFTPWEVGVRGCIESLMEKGFLS 216
             Y PT +VS+E+AKSLGI F P EV ++  +ESL EKGFLS
Sbjct: 281 KPYVPTYQVSKEKAKSLGIEFIPLEVSLKDTVESLKEKGFLS 322


Length = 322

>gnl|CDD|178567 PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178569 PLN02989, PLN02989, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|177862 PLN02214, PLN02214, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase, and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178484 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|178256 PLN02650, PLN02650, dihydroflavonol-4-reductase Back     alignment and domain information
>gnl|CDD|215100 PLN00198, PLN00198, anthocyanidin reductase; Provisional Back     alignment and domain information
>gnl|CDD|178195 PLN02583, PLN02583, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|215370 PLN02686, PLN02686, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 216
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 100.0
PLN02214342 cinnamoyl-CoA reductase 100.0
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 100.0
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 100.0
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 100.0
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 100.0
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 100.0
PLN00198338 anthocyanidin reductase; Provisional 100.0
PLN02650351 dihydroflavonol-4-reductase 100.0
PLN02896353 cinnamyl-alcohol dehydrogenase 99.97
PLN02166436 dTDP-glucose 4,6-dehydratase 99.97
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.97
PLN02572442 UDP-sulfoquinovose synthase 99.97
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.96
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.96
PLN02206442 UDP-glucuronate decarboxylase 99.96
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.96
PLN02260 668 probable rhamnose biosynthetic enzyme 99.96
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.96
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.96
PLN02427386 UDP-apiose/xylose synthase 99.96
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.96
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.96
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.96
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.96
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 99.96
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.96
PLN02240352 UDP-glucose 4-epimerase 99.95
PLN02653340 GDP-mannose 4,6-dehydratase 99.95
PLN02583297 cinnamoyl-CoA reductase 99.95
PLN02686367 cinnamoyl-CoA reductase 99.95
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.95
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.95
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.95
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.94
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.94
PLN00016378 RNA-binding protein; Provisional 99.94
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.93
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.92
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.92
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.92
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 99.91
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.9
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 99.89
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.87
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.87
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.86
PLN02996491 fatty acyl-CoA reductase 99.83
PRK07201 657 short chain dehydrogenase; Provisional 99.83
PRK05865 854 hypothetical protein; Provisional 99.81
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.8
PLN02778298 3,5-epimerase/4-reductase 99.79
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.78
CHL00194317 ycf39 Ycf39; Provisional 99.75
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.75
PLN02260668 probable rhamnose biosynthetic enzyme 99.66
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.66
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.64
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.63
KOG2774366 consensus NAD dependent epimerase [General functio 99.62
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 99.59
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.58
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.55
PLN02503605 fatty acyl-CoA reductase 2 99.54
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 99.51
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.49
COG3320382 Putative dehydrogenase domain of multifunctional n 99.44
PRK12320 699 hypothetical protein; Provisional 99.42
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.4
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.12
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.09
PRK06482276 short chain dehydrogenase; Provisional 99.06
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 99.02
PRK07074257 short chain dehydrogenase; Provisional 98.79
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 98.71
PRK08263275 short chain dehydrogenase; Provisional 98.67
PRK07775274 short chain dehydrogenase; Provisional 98.67
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.66
PRK06914280 short chain dehydrogenase; Provisional 98.64
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 98.61
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 98.59
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 98.59
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 98.56
PRK09135249 pteridine reductase; Provisional 98.56
PRK07806248 short chain dehydrogenase; Provisional 98.5
PRK06180277 short chain dehydrogenase; Provisional 98.49
KOG4288283 consensus Predicted oxidoreductase [General functi 98.48
PRK05875276 short chain dehydrogenase; Provisional 98.48
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 98.46
PRK12935247 acetoacetyl-CoA reductase; Provisional 98.45
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.39
PRK07060245 short chain dehydrogenase; Provisional 98.37
PLN03209 576 translocon at the inner envelope of chloroplast su 98.37
PRK09186256 flagellin modification protein A; Provisional 98.37
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.33
PRK06138252 short chain dehydrogenase; Provisional 98.31
PRK06123248 short chain dehydrogenase; Provisional 98.27
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 98.27
PRK12829264 short chain dehydrogenase; Provisional 98.25
PRK07067257 sorbitol dehydrogenase; Provisional 98.22
PRK12746254 short chain dehydrogenase; Provisional 98.22
PRK12828239 short chain dehydrogenase; Provisional 98.22
PRK07774250 short chain dehydrogenase; Provisional 98.21
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 98.21
PRK12827249 short chain dehydrogenase; Provisional 98.21
PRK06182273 short chain dehydrogenase; Validated 98.19
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.17
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 98.15
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 98.13
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.13
PRK07577234 short chain dehydrogenase; Provisional 98.1
PF1395062 Epimerase_Csub: UDP-glucose 4-epimerase C-term sub 98.09
PRK08219227 short chain dehydrogenase; Provisional 98.05
PRK05876275 short chain dehydrogenase; Provisional 98.05
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 98.04
PRK08017256 oxidoreductase; Provisional 98.03
PRK08628258 short chain dehydrogenase; Provisional 98.02
PRK06128300 oxidoreductase; Provisional 98.01
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.0
PRK06500249 short chain dehydrogenase; Provisional 98.0
PRK05650270 short chain dehydrogenase; Provisional 97.99
PRK08324681 short chain dehydrogenase; Validated 97.99
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.99
PRK06179270 short chain dehydrogenase; Provisional 97.98
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 97.97
PRK07523255 gluconate 5-dehydrogenase; Provisional 97.96
PRK07890258 short chain dehydrogenase; Provisional 97.95
PRK06701290 short chain dehydrogenase; Provisional 97.89
PRK12939250 short chain dehydrogenase; Provisional 97.88
PRK06181263 short chain dehydrogenase; Provisional 97.86
PRK07069251 short chain dehydrogenase; Validated 97.83
PRK10538248 malonic semialdehyde reductase; Provisional 97.82
PRK06057255 short chain dehydrogenase; Provisional 97.8
PRK06124256 gluconate 5-dehydrogenase; Provisional 97.76
PRK07041230 short chain dehydrogenase; Provisional 97.74
PRK08213259 gluconate 5-dehydrogenase; Provisional 97.72
PRK12824245 acetoacetyl-CoA reductase; Provisional 97.72
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 97.72
PRK06196315 oxidoreductase; Provisional 97.7
PRK09291257 short chain dehydrogenase; Provisional 97.7
PRK05717255 oxidoreductase; Validated 97.69
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 97.65
PRK08251248 short chain dehydrogenase; Provisional 97.65
PRK09134258 short chain dehydrogenase; Provisional 97.65
PRK08085254 gluconate 5-dehydrogenase; Provisional 97.64
PRK07985294 oxidoreductase; Provisional 97.63
PRK12938246 acetyacetyl-CoA reductase; Provisional 97.63
PRK06841255 short chain dehydrogenase; Provisional 97.62
PRK08264238 short chain dehydrogenase; Validated 97.61
PRK07825273 short chain dehydrogenase; Provisional 97.6
PRK12937245 short chain dehydrogenase; Provisional 97.59
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.58
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.57
PRK07035252 short chain dehydrogenase; Provisional 97.56
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.56
PRK07453322 protochlorophyllide oxidoreductase; Validated 97.54
PRK12744257 short chain dehydrogenase; Provisional 97.53
PRK07109334 short chain dehydrogenase; Provisional 97.52
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.5
PRK07024257 short chain dehydrogenase; Provisional 97.5
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 97.49
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 97.47
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 97.47
PRK07454241 short chain dehydrogenase; Provisional 97.46
PRK06924251 short chain dehydrogenase; Provisional 97.46
PRK06101240 short chain dehydrogenase; Provisional 97.45
PRK12747252 short chain dehydrogenase; Provisional 97.44
PRK06194287 hypothetical protein; Provisional 97.44
PRK07904253 short chain dehydrogenase; Provisional 97.44
PRK05993277 short chain dehydrogenase; Provisional 97.43
PRK06947248 glucose-1-dehydrogenase; Provisional 97.42
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 97.42
PRK07097265 gluconate 5-dehydrogenase; Provisional 97.41
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.4
PRK08589272 short chain dehydrogenase; Validated 97.35
PRK06198260 short chain dehydrogenase; Provisional 97.35
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.35
PRK05693274 short chain dehydrogenase; Provisional 97.34
PRK12743256 oxidoreductase; Provisional 97.34
PLN02253280 xanthoxin dehydrogenase 97.33
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 97.32
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 97.32
PRK07814263 short chain dehydrogenase; Provisional 97.31
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 97.3
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 97.3
TIGR02415254 23BDH acetoin reductases. One member of this famil 97.29
PRK08277278 D-mannonate oxidoreductase; Provisional 97.29
PRK07102243 short chain dehydrogenase; Provisional 97.27
PRK06484520 short chain dehydrogenase; Validated 97.26
PRK07856252 short chain dehydrogenase; Provisional 97.26
PRK06114254 short chain dehydrogenase; Provisional 97.25
PRK09242257 tropinone reductase; Provisional 97.22
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 97.19
PRK06523260 short chain dehydrogenase; Provisional 97.16
PRK06172253 short chain dehydrogenase; Provisional 97.11
PRK12742237 oxidoreductase; Provisional 97.06
PRK06197306 short chain dehydrogenase; Provisional 97.03
PRK07478254 short chain dehydrogenase; Provisional 97.02
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.0
PRK08936261 glucose-1-dehydrogenase; Provisional 96.95
PRK08226263 short chain dehydrogenase; Provisional 96.92
PRK06949258 short chain dehydrogenase; Provisional 96.91
PRK07576264 short chain dehydrogenase; Provisional 96.9
PRK07677252 short chain dehydrogenase; Provisional 96.9
PRK08643256 acetoin reductase; Validated 96.9
PRK07578199 short chain dehydrogenase; Provisional 96.87
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.84
PRK07832272 short chain dehydrogenase; Provisional 96.81
PRK07023243 short chain dehydrogenase; Provisional 96.79
PRK08265261 short chain dehydrogenase; Provisional 96.77
PRK07831262 short chain dehydrogenase; Provisional 96.75
PRK08703239 short chain dehydrogenase; Provisional 96.75
smart00822180 PKS_KR This enzymatic domain is part of bacterial 96.74
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.68
PRK05854313 short chain dehydrogenase; Provisional 96.67
PRK06483236 dihydromonapterin reductase; Provisional 96.64
PRK08267260 short chain dehydrogenase; Provisional 96.63
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 96.57
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.55
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 96.55
PRK05872296 short chain dehydrogenase; Provisional 96.54
PRK06139330 short chain dehydrogenase; Provisional 96.54
PRK05867253 short chain dehydrogenase; Provisional 96.53
PRK07063260 short chain dehydrogenase; Provisional 96.4
PRK09072263 short chain dehydrogenase; Provisional 96.35
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 96.34
PRK07326237 short chain dehydrogenase; Provisional 96.26
PRK07201657 short chain dehydrogenase; Provisional 96.25
PRK05866293 short chain dehydrogenase; Provisional 96.15
PRK06398258 aldose dehydrogenase; Validated 96.09
COG2910211 Putative NADH-flavin reductase [General function p 96.09
PRK06953222 short chain dehydrogenase; Provisional 96.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 95.99
PLN02780320 ketoreductase/ oxidoreductase 95.94
PRK06940275 short chain dehydrogenase; Provisional 95.89
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 95.75
PRK08339263 short chain dehydrogenase; Provisional 95.73
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 95.53
PRK07062265 short chain dehydrogenase; Provisional 95.52
PF08732410 HIM1: HIM1; InterPro: IPR014843 HIM1 (high inducti 95.5
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 95.49
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 95.46
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 95.45
PRK05855582 short chain dehydrogenase; Validated 95.3
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 95.29
PRK08177225 short chain dehydrogenase; Provisional 95.26
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 95.18
PRK09009235 C factor cell-cell signaling protein; Provisional 95.17
PRK06484 520 short chain dehydrogenase; Validated 95.04
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 94.96
PRK07791286 short chain dehydrogenase; Provisional 94.94
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.89
KOG1208314 consensus Dehydrogenases with different specificit 94.7
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 94.7
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 94.65
PLN00015308 protochlorophyllide reductase 94.55
PRK08340259 glucose-1-dehydrogenase; Provisional 94.39
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 94.35
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 94.21
PRK05599246 hypothetical protein; Provisional 94.01
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 93.58
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 93.51
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.5
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 93.41
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 93.36
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 93.04
PRK05884223 short chain dehydrogenase; Provisional 92.74
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 92.72
PRK08278273 short chain dehydrogenase; Provisional 92.63
PRK06125259 short chain dehydrogenase; Provisional 92.45
PRK08862227 short chain dehydrogenase; Provisional 92.36
PRK08303305 short chain dehydrogenase; Provisional 91.97
COG0300265 DltE Short-chain dehydrogenases of various substra 91.68
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 90.61
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 90.27
PLN02730303 enoyl-[acyl-carrier-protein] reductase 89.15
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 88.7
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 88.67
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 87.57
KOG1611249 consensus Predicted short chain-type dehydrogenase 85.86
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 85.61
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 85.51
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 85.5
KOG0725270 consensus Reductases with broad range of substrate 83.0
COG1028251 FabG Dehydrogenases with different specificities ( 82.75
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 81.85
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
Probab=100.00  E-value=5.7e-36  Score=225.34  Aligned_cols=216  Identities=46%  Similarity=0.730  Sum_probs=189.9

Q ss_pred             CcHHHHHHHHhccCCccEEEEcccccccccCCCCCCCCccccCCCCCCcccccccchhHHHHHHHHHHHHHHHHHHcCCc
Q 027988            1 MGTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSLAKTLAEEAAWKFAKENGID   80 (216)
Q Consensus         1 ~gt~~ll~~~~~~~~~~~~i~~Ss~~~vy~~~~~~~~~~~~~E~~~~~~~~~~~~~~~Y~~sK~~~E~~~~~~~~~~~~~   80 (216)
                      .||.|+|++|.+.+.|+|||++||++++..+....++...++|++|.++........+|..||..+|+.+|+++++.+++
T Consensus       106 ~Gt~nVL~ac~~~~sVkrvV~TSS~aAv~~~~~~~~~~~vvdE~~wsd~~~~~~~~~~Y~~sK~lAEkaAw~fa~e~~~~  185 (327)
T KOG1502|consen  106 KGTKNVLEACKKTKSVKRVVYTSSTAAVRYNGPNIGENSVVDEESWSDLDFCRCKKLWYALSKTLAEKAAWEFAKENGLD  185 (327)
T ss_pred             HHHHHHHHHHhccCCcceEEEeccHHHhccCCcCCCCCcccccccCCcHHHHHhhHHHHHHHHHHHHHHHHHHHHhCCcc
Confidence            48999999999986799999999998888764555568899999999998776666899999999999999999999999


Q ss_pred             EEEEcCCCccCCCCCCCCCccHHHHHHHHcCC-CCCC-CCCceeehhhhHHHHHHhhcCCCCCceEEEecCCCCHHHHHH
Q 027988           81 LVAIHPGTVIGPFFQPILNFGAEVILNLINGD-QSFA-FPYIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILK  158 (216)
Q Consensus        81 ~~ilR~~~v~G~~~~~~~~~~~~~~~~~~~~~-~~~~-~~~~~i~v~D~a~~~~~~~~~~~~~~~~~~~~~~~s~~el~~  158 (216)
                      .+++-|+.|+||...+..+.....+.++++|. ..++ ....|||++|+|.|++.+++.+...|+|+|+++..++.|+++
T Consensus       186 lv~inP~lV~GP~l~~~l~~s~~~~l~~i~G~~~~~~n~~~~~VdVrDVA~AHv~a~E~~~a~GRyic~~~~~~~~ei~~  265 (327)
T KOG1502|consen  186 LVTINPGLVFGPGLQPSLNSSLNALLKLIKGLAETYPNFWLAFVDVRDVALAHVLALEKPSAKGRYICVGEVVSIKEIAD  265 (327)
T ss_pred             EEEecCCceECCCcccccchhHHHHHHHHhcccccCCCCceeeEeHHHHHHHHHHHHcCcccCceEEEecCcccHHHHHH
Confidence            99999999999999987777788889999997 6666 666799999999999999999999999999999888999999


Q ss_pred             HHHHhCCCCCCCCCCcc---CCCCccccchHHHHHhC-CeeeehhhhHHHHHHHHHHcCCCC
Q 027988          159 FLREHYPTLLRSGKLEE---KYQPTIKVSQERAKSLG-INFTPWEVGVRGCIESLMEKGFLS  216 (216)
Q Consensus       159 ~i~~~~~~~~~~~~~~~---~~~~~~~~d~~k~~~lg-~~~~~~~~~i~~~~~~~~~~~~l~  216 (216)
                      ++.+.+|...+|.....   .......++++|++.|| |++++++|++.++++++++.++++
T Consensus       266 ~l~~~~P~~~ip~~~~~~~~~~~~~~~~~~~k~k~lg~~~~~~l~e~~~dt~~sl~~~~~l~  327 (327)
T KOG1502|consen  266 ILRELFPDYPIPKKNAEEHEGFLTSFKVSSEKLKSLGGFKFRPLEETLSDTVESLREKGLLL  327 (327)
T ss_pred             HHHHhCCCCCCCCCCCccccccccccccccHHHHhcccceecChHHHHHHHHHHHHHhcCCC
Confidence            99999998887765442   22233468999998887 788999999999999999999874



>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF08732 HIM1: HIM1; InterPro: IPR014843 HIM1 (high induction of mutagenesis protein 1) plays a role in the control of spontaneous and induced mutagenesis [] Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
2c29_D337 Structure Of Dihydroflavonol Reductase From Vitis V 4e-25
2rh8_A338 Structure Of Apo Anthocyanidin Reductase From Vitis 2e-21
2p4h_X322 Crystal Structure Of Vestitone Reductase From Alfal 1e-13
1y1p_A342 X-Ray Structure Of Aldehyde Reductase With Nadph Le 4e-12
1ujm_A342 Crystal Structure Of Aldehyde Reductase 2 From Spor 3e-10
>pdb|2C29|D Chain D, Structure Of Dihydroflavonol Reductase From Vitis Vinifera At 1.8 A. Length = 337 Back     alignment and structure

Iteration: 1

Score = 110 bits (276), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 75/223 (33%), Positives = 114/223 (51%), Gaps = 12/223 (5%) Query: 2 GTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENK--EW- 58 G L +++SCA +++R+V TSS G + + E + V DE+ +S+ C+ K W Sbjct: 106 GMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLP---VYDESCWSDMEFCRAKKMTAWM 162 Query: 59 YSLAKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQ---SF 115 Y ++KTLAE+AAWK+AKEN ID + I P V+GPF + L+ I G++ S Sbjct: 163 YFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSI 222 Query: 116 AFPYIFVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYP--TLLRSGKL 173 FV + D+ AHI E PKA GRY+ + D+ K LRE YP + K Sbjct: 223 IRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKG 282 Query: 174 EEKYQPTIKVSQERAKSLGINFT-PWEVGVRGCIESLMEKGFL 215 ++ ++ S ++ LG F E G +++ KG L Sbjct: 283 VDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLL 325
>pdb|2RH8|A Chain A, Structure Of Apo Anthocyanidin Reductase From Vitis Vinifera Length = 338 Back     alignment and structure
>pdb|2P4H|X Chain X, Crystal Structure Of Vestitone Reductase From Alfalfa (Medicago Sativa L.) Length = 322 Back     alignment and structure
>pdb|1Y1P|A Chain A, X-Ray Structure Of Aldehyde Reductase With Nadph Length = 342 Back     alignment and structure
>pdb|1UJM|A Chain A, Crystal Structure Of Aldehyde Reductase 2 From Sporobolomyces Salmonicolor Aku4429 Length = 342 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 7e-84
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 2e-83
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 3e-83
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 1e-65
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 2e-36
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 7e-31
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 3e-14
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 3e-10
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 3e-10
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 1e-09
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 4e-09
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 2e-08
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 4e-08
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 6e-08
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 1e-07
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 2e-06
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 4e-06
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 5e-06
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 7e-06
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 7e-06
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 8e-06
1xq6_A253 Unknown protein; structural genomics, protein stru 5e-05
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 7e-05
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 1e-04
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 2e-04
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 2e-04
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 6e-04
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 7e-04
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 8e-04
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 9e-04
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 Back     alignment and structure
 Score =  251 bits (643), Expect = 7e-84
 Identities = 73/223 (32%), Positives = 111/223 (49%), Gaps = 12/223 (5%)

Query: 2   GTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKE---W 58
           G L +++SCA   +++R+V TSS G + + E       V DE+ +S+   C+  K     
Sbjct: 106 GMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQ---LPVYDESCWSDMEFCRAKKMTAWM 162

Query: 59  YSLAKTLAEEAAWKFAKENGIDLVAIHPGTVIGPFFQPILNFGAEVILNLINGDQSFAFP 118
           Y ++KTLAE+AAWK+AKEN ID + I P  V+GPF    +       L+ I G+++    
Sbjct: 163 YFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSI 222

Query: 119 YI---FVEIRDVVYAHIRALEVPKASGRYLLAGSVAQHSDILKFLREHYPTLL--RSGKL 173
                FV + D+  AHI   E PKA GRY+ +       D+ K LRE YP        K 
Sbjct: 223 IRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKG 282

Query: 174 EEKYQPTIKVSQERAKSLGINFT-PWEVGVRGCIESLMEKGFL 215
            ++   ++  S ++   LG  F    E    G +++   KG L
Sbjct: 283 VDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLL 325


>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Length = 342 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} PDB: 3icp_A* 3aw9_A* Length = 312 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} Length = 313 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Length = 321 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Length = 377 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Length = 369 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Length = 310 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 100.0
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 100.0
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.98
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.98
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.97
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.97
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.97
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.97
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.97
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.97
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.97
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.97
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.97
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.96
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.96
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.96
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.96
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.96
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.96
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.96
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.96
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.96
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.96
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.96
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.96
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.96
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.96
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.96
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.96
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.96
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.96
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.96
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.96
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.96
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.96
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.95
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.95
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.95
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.95
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.95
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.95
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.95
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.95
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.95
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.95
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.95
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.95
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.94
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.94
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.94
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.94
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.94
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.94
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.93
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.93
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.93
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.92
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.9
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.86
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.86
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.86
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.83
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.82
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.8
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.78
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.78
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.76
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.73
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.72
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.67
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.66
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.63
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.62
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.62
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.61
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.61
1xq6_A253 Unknown protein; structural genomics, protein stru 99.55
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.53
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.5
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.43
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.4
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.32
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.24
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.24
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.23
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.22
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.22
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.13
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.13
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.03
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.0
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 98.95
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 98.94
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 98.87
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 98.86
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 98.84
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 98.82
1spx_A278 Short-chain reductase family member (5L265); paral 98.77
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 98.77
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 98.77
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 98.76
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 98.74
1xq1_A266 Putative tropinone reducatse; structural genomics, 98.7
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 98.7
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 98.7
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.69
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 98.68
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 98.63
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 98.63
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 98.62
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 98.62
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 98.61
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 98.58
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 98.56
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 98.56
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.55
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 98.55
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 98.55
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 98.54
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 98.53
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 98.53
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 98.53
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 98.52
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 98.48
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 98.48
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 98.48
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 98.47
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 98.46
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 98.44
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 98.43
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 98.43
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 98.43
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 98.42
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 98.41
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 98.39
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 98.39
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.38
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 98.37
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.36
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 98.36
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 98.35
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 98.35
1nff_A260 Putative oxidoreductase RV2002; directed evolution 98.35
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 98.35
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 98.35
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 98.35
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 98.35
3imf_A257 Short chain dehydrogenase; structural genomics, in 98.34
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 98.33
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 98.32
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 98.32
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 98.31
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 98.31
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 98.31
3rih_A293 Short chain dehydrogenase or reductase; structural 98.31
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 98.3
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 98.29
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 98.29
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 98.29
3gem_A260 Short chain dehydrogenase; structural genomics, AP 98.29
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 98.28
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 98.27
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 98.27
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 98.26
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.26
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 98.26
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 98.26
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 98.25
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 98.25
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 98.25
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 98.24
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 98.24
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 98.24
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 98.24
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.23
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 98.22
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 98.22
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 98.22
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 98.22
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 98.22
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 98.21
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 98.21
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 98.21
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 98.21
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 98.21
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 98.2
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 98.2
3cxt_A291 Dehydrogenase with different specificities; rossma 98.19
3tox_A280 Short chain dehydrogenase; structural genomics, PS 98.19
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 98.18
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 98.18
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 98.17
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 98.16
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 98.16
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 98.16
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 98.15
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 98.15
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 98.14
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 98.14
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.14
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 98.13
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 98.13
4eso_A255 Putative oxidoreductase; NADP, structural genomics 98.13
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 98.12
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 98.12
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 98.12
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 98.12
3qlj_A322 Short chain dehydrogenase; structural genomics, se 98.12
4e4y_A244 Short chain dehydrogenase family protein; structur 98.11
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 98.11
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 98.11
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 98.1
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 98.09
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 98.09
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 98.09
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 98.08
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 98.06
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 98.06
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 98.05
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 98.05
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 98.04
3edm_A259 Short chain dehydrogenase; structural genomics, ox 98.04
4dqx_A277 Probable oxidoreductase protein; structural genomi 98.04
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 98.04
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.04
1xhl_A297 Short-chain dehydrogenase/reductase family member 98.03
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 98.03
3tjr_A301 Short chain dehydrogenase; structural genomics, se 98.03
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 98.02
1xkq_A280 Short-chain reductase family member (5D234); parra 98.02
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 98.02
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 98.01
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 98.0
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 97.99
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 97.99
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 97.99
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 97.98
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 97.98
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 97.97
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 97.97
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.95
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 97.94
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 97.94
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 97.92
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 97.91
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 97.91
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 97.9
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.9
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 97.88
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 97.87
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 97.87
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.87
3tsc_A277 Putative oxidoreductase; structural genomics, seat 97.85
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.85
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 97.85
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 97.82
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 97.82
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 97.82
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 97.82
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 97.81
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 97.79
1ooe_A236 Dihydropteridine reductase; structural genomics, P 97.79
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 97.78
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 97.78
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 97.78
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 97.78
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 97.74
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.68
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 97.67
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 97.66
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 97.61
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 97.59
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 97.58
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 97.49
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 97.46
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 97.41
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.38
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 97.34
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 97.31
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 97.3
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 97.28
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 97.24
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 97.24
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 97.2
3e03_A274 Short chain dehydrogenase; structural genomics, PS 97.18
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 97.1
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 97.08
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 97.03
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.95
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 96.93
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 96.75
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 96.7
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 96.66
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 96.6
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 96.58
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 96.55
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 96.33
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 96.15
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 96.04
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 95.98
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 95.87
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 95.51
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 95.49
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 94.62
3slk_A795 Polyketide synthase extender module 2; rossmann fo 92.38
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 90.33
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 89.97
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 88.56
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 84.16
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 81.47
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
Probab=100.00  E-value=3.7e-32  Score=209.99  Aligned_cols=200  Identities=15%  Similarity=0.154  Sum_probs=162.1

Q ss_pred             cHHHHHHHHhccCCccEEEEcccccccccCCCCCCCCccccCCCCCCcccccccchhHHHHHHHHHHHHHHHHHHcCCcE
Q 027988            2 GTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSLAKTLAEEAAWKFAKENGIDL   81 (216)
Q Consensus         2 gt~~ll~~~~~~~~~~~~i~~Ss~~~vy~~~~~~~~~~~~~E~~~~~~~~~~~~~~~Y~~sK~~~E~~~~~~~~~~~~~~   81 (216)
                      ||.+|+++|.+. ++++|||+||. .+|+...    ..+++|+++..|.      +.|+.+|+.+|++++.++++.++++
T Consensus        88 ~~~~ll~a~~~~-~~~r~v~~SS~-~vyg~~~----~~~~~E~~~~~p~------~~Y~~sK~~~E~~~~~~~~~~g~~~  155 (311)
T 3m2p_A           88 LTQNLYDACYEN-NISNIVYASTI-SAYSDET----SLPWNEKELPLPD------LMYGVSKLACEHIGNIYSRKKGLCI  155 (311)
T ss_dssp             HHHHHHHHHHHT-TCCEEEEEEEG-GGCCCGG----GCSBCTTSCCCCS------SHHHHHHHHHHHHHHHHHHHSCCEE
T ss_pred             HHHHHHHHHHHc-CCCEEEEEccH-HHhCCCC----CCCCCCCCCCCCC------chhHHHHHHHHHHHHHHHHHcCCCE
Confidence            689999999998 89999999997 9998765    6788999876665      5699999999999999998889999


Q ss_pred             EEEcCCCccCCCCCCCCCccHHHHHHHHcCC-C-CCC---CCCceeehhhhHHHHHHhhcCCCCCceEEEe-cCCCCHHH
Q 027988           82 VAIHPGTVIGPFFQPILNFGAEVILNLINGD-Q-SFA---FPYIFVEIRDVVYAHIRALEVPKASGRYLLA-GSVAQHSD  155 (216)
Q Consensus        82 ~ilR~~~v~G~~~~~~~~~~~~~~~~~~~~~-~-~~~---~~~~~i~v~D~a~~~~~~~~~~~~~~~~~~~-~~~~s~~e  155 (216)
                      +++||++|||++..+. +....++..+..+. . .++   ..++|+|++|+|++++.+++++..++.|+++ ++.+|+.|
T Consensus       156 ~ilRp~~v~G~~~~~~-~~~~~~~~~~~~~~~~~~~g~~~~~~~~v~v~Dva~a~~~~~~~~~~~~~~~i~~~~~~s~~e  234 (311)
T 3m2p_A          156 KNLRFAHLYGFNEKNN-YMINRFFRQAFHGEQLTLHANSVAKREFLYAKDAAKSVIYALKQEKVSGTFNIGSGDALTNYE  234 (311)
T ss_dssp             EEEEECEEECSCC--C-CHHHHHHHHHHTCCCEEESSBCCCCEEEEEHHHHHHHHHHHTTCTTCCEEEEECCSCEECHHH
T ss_pred             EEEeeCceeCcCCCCC-CHHHHHHHHHHcCCCeEEecCCCeEEceEEHHHHHHHHHHHHhcCCCCCeEEeCCCCcccHHH
Confidence            9999999999997654 35567777787787 3 333   5668999999999999999887766688776 77899999


Q ss_pred             HHHHHHHhCCCCCCC--CCC-ccCCCCccccchHHH-HHhCCee-eehhhhHHHHHHHHHHcCC
Q 027988          156 ILKFLREHYPTLLRS--GKL-EEKYQPTIKVSQERA-KSLGINF-TPWEVGVRGCIESLMEKGF  214 (216)
Q Consensus       156 l~~~i~~~~~~~~~~--~~~-~~~~~~~~~~d~~k~-~~lg~~~-~~~~~~i~~~~~~~~~~~~  214 (216)
                      +++.+.+.++.....  ... .........+|++|+ +.|||+| .+++++|+++++|+++.+-
T Consensus       235 ~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~d~~k~~~~lG~~p~~~~~~~l~~~~~~~~~~~~  298 (311)
T 3m2p_A          235 VANTINNAFGNKDNLLVKNPNANEGIHSSYMDSSKAKELLDFSTDYNFATAVEEIHLLMRGLDD  298 (311)
T ss_dssp             HHHHHHHHTTCTTCEEECSSSBCCSCCCBCBCCHHHHHHSCCCCSCCHHHHHHHHHHHHCC---
T ss_pred             HHHHHHHHhCCCCcceecCCCCCCCcCceecCHHHHHHHhCCCcccCHHHHHHHHHHHHHhccc
Confidence            999999999654211  111 133456778999999 6699999 6999999999999987653



>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 216
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 3e-14
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 3e-12
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 5e-12
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 2e-10
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 5e-10
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 1e-08
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 1e-05
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 0.004
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Aldehyde reductase II
species: Sporobolomyces salmonicolor [TaxId: 5005]
 Score = 68.3 bits (165), Expect = 3e-14
 Identities = 61/231 (26%), Positives = 94/231 (40%), Gaps = 23/231 (9%)

Query: 1   MGTLNVLRSCAKVHSIKRVVLTSSIGAMLLNE---------TPMTPDVVIDETWFSNPVL 51
            GTLN LR+ A   S+KR VLTSS  + L+ +                 ID+        
Sbjct: 109 GGTLNALRAAAATPSVKRFVLTSSTVSALIPKPNVEGIYLDEKSWNLESIDKAKTLPESD 168

Query: 52  CKENKEWYSLAKTLAEEAAWKFAKENGI--DLVAIHPGTVIGPFFQPILNFGA--EVILN 107
            +++   Y+ +KT AE AAWKF  EN     L A+ P   IG  F P    G+    +++
Sbjct: 169 PQKSLWVYAASKTEAELAAWKFMDENKPHFTLNAVLPNYTIGTIFDPETQSGSTSGWMMS 228

Query: 108 LINGDQSFAFP----YIFVEIRDVVYAHIRALEVPKASGRY-LLAGSVAQHSDILKFLRE 162
           L NG+ S A        +V   D+   H+  L +P+   R           + +L   R+
Sbjct: 229 LFNGEVSPALALMPPQYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRK 288

Query: 163 HYPTLLRSGKLEEK----YQPTIKVSQERAKSLGI-NFTPWEVGVRGCIES 208
            YP+        ++     +     S E  KSLG   +   E  ++  + S
Sbjct: 289 LYPSKTFPADFPDQGQDLSKFDTAPSLEILKSLGRPGWRSIEESIKDLVGS 339


>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 100.0
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 100.0
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 100.0
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.97
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.97
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.97
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.97
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.97
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.96
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.96
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.95
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.95
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.95
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.95
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.94
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.94
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.94
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.92
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.9
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.89
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.88
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.8
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.53
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.46
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.43
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.39
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.24
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.12
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 98.98
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 97.69
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 97.43
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 97.22
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 97.13
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 97.1
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.1
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.09
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 97.05
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 97.04
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 97.04
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 96.95
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.94
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.93
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.89
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.88
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.86
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.84
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 96.75
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.74
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 96.73
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 96.73
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 96.63
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 96.63
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 96.58
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 96.57
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 96.56
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 96.55
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 96.44
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 96.35
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 96.35
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.2
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 96.2
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 96.14
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 96.14
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 96.01
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 96.01
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 95.98
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 95.89
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 95.88
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 95.86
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 95.76
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 95.73
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 95.31
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 95.23
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 95.18
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 95.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 94.93
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 94.89
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 94.88
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 94.76
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 94.75
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 94.48
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 93.91
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 93.69
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 93.59
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 93.1
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 92.55
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 91.76
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 91.14
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 90.71
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 90.5
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 90.2
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 89.78
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 89.16
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 84.7
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptomyces venezuelae [TaxId: 54571]
Probab=100.00  E-value=8.2e-36  Score=229.68  Aligned_cols=198  Identities=17%  Similarity=0.184  Sum_probs=165.8

Q ss_pred             cHHHHHHHHhccCCccEEEEcccccccccCCCCCCCCccccCCCCCCcccccccchhHHHHHHHHHHHHHHHHHHcCCcE
Q 027988            2 GTLNVLRSCAKVHSIKRVVLTSSIGAMLLNETPMTPDVVIDETWFSNPVLCKENKEWYSLAKTLAEEAAWKFAKENGIDL   81 (216)
Q Consensus         2 gt~~ll~~~~~~~~~~~~i~~Ss~~~vy~~~~~~~~~~~~~E~~~~~~~~~~~~~~~Y~~sK~~~E~~~~~~~~~~~~~~   81 (216)
                      ||.+|+++|.+. ++++|||+||+ ++||...    ..+++|+++..|.      ++||.||..+|.+++.+.+++++++
T Consensus       106 gt~~ll~~~~~~-~~~~~I~~Ss~-~~yg~~~----~~~~~E~~~~~p~------~~Y~~sK~~~E~~~~~~~~~~~~~~  173 (322)
T d1r6da_         106 GTQTLLQCAVDA-GVGRVVHVSTN-QVYGSID----SGSWTESSPLEPN------SPYAASKAGSDLVARAYHRTYGLDV  173 (322)
T ss_dssp             HHHHHHHHHHHT-TCCEEEEEEEG-GGGCCCS----SSCBCTTSCCCCC------SHHHHHHHHHHHHHHHHHHHHCCCE
T ss_pred             HHHHHHHHHHHc-CCceEEEeecc-eeecCCC----CCCCCCCCCCCCC------CHHHHHHHHHHHHHHHHHHHhCCCE
Confidence            789999999998 88999999997 9999876    6789999887765      5699999999999999999999999


Q ss_pred             EEEcCCCccCCCCCCCCCccHHHHHHHHcCC--CCCC---CCCceeehhhhHHHHHHhhcCCCCCceEEEe-cCCCCHHH
Q 027988           82 VAIHPGTVIGPFFQPILNFGAEVILNLINGD--QSFA---FPYIFVEIRDVVYAHIRALEVPKASGRYLLA-GSVAQHSD  155 (216)
Q Consensus        82 ~ilR~~~v~G~~~~~~~~~~~~~~~~~~~~~--~~~~---~~~~~i~v~D~a~~~~~~~~~~~~~~~~~~~-~~~~s~~e  155 (216)
                      +++||++||||++.+. ..++.++.++.+|+  ..++   ..++|+|++|+|+++..+++++..++.|+++ +..+++.|
T Consensus       174 ~~lR~~~vyGp~~~~~-~~i~~~i~~~~~~~~i~v~~~g~~~r~~i~v~D~a~ai~~~~~~~~~~~~~ni~~~~~~s~~e  252 (322)
T d1r6da_         174 RITRCCNNYGPYQHPE-KLIPLFVTNLLDGGTLPLYGDGANVREWVHTDDHCRGIALVLAGGRAGEIYHIGGGLELTNRE  252 (322)
T ss_dssp             EEEEECEEECTTCCTT-SHHHHHHHHHHTTCCEEEETTSCCEEEEEEHHHHHHHHHHHHHHCCTTCEEEECCCCEEEHHH
T ss_pred             EEEEeeeEECcCCCcC-cHHHHHHHHHHcCCCcEEecCCCeEEccEEHHHHHHHHHHHHhCCCCCCeeEEeecccchhHH
Confidence            9999999999987654 35678888888888  3344   4558999999999999999988777788666 78899999


Q ss_pred             HHHHHHHhCCCCCCC-CC--CccCCCCccccchHHH-HHhCCee-eehhhhHHHHHHHHHHc
Q 027988          156 ILKFLREHYPTLLRS-GK--LEEKYQPTIKVSQERA-KSLGINF-TPWEVGVRGCIESLMEK  212 (216)
Q Consensus       156 l~~~i~~~~~~~~~~-~~--~~~~~~~~~~~d~~k~-~~lg~~~-~~~~~~i~~~~~~~~~~  212 (216)
                      +++.+.+.++..... ..  ..........+|++|+ +.|||+| ++++|+|+++++|++++
T Consensus       253 ~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~d~~k~~~~lg~~p~~~~eegI~~~i~w~~~n  314 (322)
T d1r6da_         253 LTGILLDSLGADWSSVRKVADRKGHDLRYSLDGGKIERELGYRPQVSFADGLARTVRWYREN  314 (322)
T ss_dssp             HHHHHHHHHTCCGGGEEEECCCTTCCCBCCBCCHHHHHHHCCCCCSCHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHhCCCccceeecCCCCCCCceeeeCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHh
Confidence            999999998643211 11  1133444577999999 7899999 89999999999999874



>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure